Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Alpha-2A adrenergic receptor
Species	Rattus norvegicus (Rat)
Gene	Adra2a
Synonym	CA2-47 alpha2D alpha2A-AR alpha2A-adrenoceptor alpha2A-adrenergic receptor alpha2A Alpha-2D adrenergic receptor Alpha-2AAR Alpha-2A adrenoreceptor Alpha-2A adrenoceptor adrenergic receptor Adrenergic alpha 2A receptor ADRA2R ADRA2 Adra-2a Adra-2 [ Show all ]
Disease	N/A for non-human GPCRs
Length	450
Amino acid sequence	MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGGQQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACSAPPGGADRRPNGLGPERGAGTAGAEAEPLPTQLNGAPGEPAPTRPRDGDALDLEESSSSEHAERPQGPGKPERGPRAKGKTKASQVKPGDSLPRRGPGAAGPGASGSGQGEERAGGAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPYQLFNFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
UniProt	P22909
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL327
IUPHAR	N/A
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
5880	CHEMBL209176	C21H29N3O2S	387.542	5 / 1	3.6	Yes
7451	CHEMBL377697	C25H40N4O3S	476.68	6 / 2	3.7	Yes
10523	CHEMBL30739	C13H16N2S	232.345	2 / 1	3.2	Yes
18664	CHEMBL286246	C11H10N2S	202.275	2 / 1	2.1	Yes
19847	CHEMBL177101	C13H16F4N2O2S	340.337	8 / 2	2.2	Yes
19848	CHEMBL177621	C13H16F4N2O2S	340.337	8 / 2	2.2	Yes
21864	OPC-28326	C26H35N3O2	421.585	3 / 1	4.3	Yes
22603	CHEMBL284213	C11H12N2S	204.291	2 / 1	2.3	Yes
23240	DIHYDREXIDINE	C17H17NO2	267.328	3 / 3	2.5	Yes
24972	CHEMBL596352	C6H3Br3OS	362.861	2 / 0	3.8	Yes
25150	CHEMBL340641	C24H26Cl2N4O	457.399	4 / 1	5.3	No
26054	S-(-)-Lisuride	C20H26N4O	338.455	2 / 2	2.7	Yes
26573	Yohimbine	C21H26N2O3	354.45	4 / 2	2.9	Yes
31148	CHEMBL566522	C19H19FN6	350.401	5 / 1	2.9	Yes
33391	CHEMBL420510	C26H32N4O2	432.568	4 / 0	3.8	Yes
34924	CHEMBL385371	C26H30ClNO4	455.979	5 / 2	N/A	N/A
35775	CHEMBL286269	C11H12N2S	204.291	2 / 1	2.5	Yes
39691	CHEMBL266832	C22H36N4O3S	436.615	6 / 2	2.7	Yes
47206	CHEMBL209985	C19H32N4O3S	396.55	6 / 2	1.7	Yes
50186	CHEMBL466462	C18H20FN5O2	357.389	7 / 2	-0.4	Yes
50189	CHEMBL511555	C18H20FN5O2	357.389	7 / 2	-0.4	Yes
50753	DEXMEDETOMIDINE	C13H16N2	200.285	1 / 1	3.1	Yes
53692	CHEMBL339960	C23H26Cl2N4O	445.388	3 / 2	5.3	No
56679	cisapride	C23H29ClFN3O4	465.95	7 / 2	3.4	Yes
59988	CHEMBL558226	C16H21Cl2N3O2	358.263	4 / 3	N/A	N/A
60315	Talipexole	C10H15N3S	209.311	4 / 1	1.5	Yes
63179	phenylpropanolamine	C9H13NO	151.209	2 / 2	0.8	Yes
64673	PD-168077	C20H22N4O	334.423	4 / 1	3.0	Yes
67201	Probes1_000120	C21H24N2O2	336.435	2 / 0	3.2	Yes
69482	CHEMBL174274	C14H21FN2O3S	316.391	6 / 2	0.9	Yes
69483	CHEMBL177936	C14H21FN2O3S	316.391	6 / 2	0.9	Yes
69941	2-Chloro-1-(3,4-dibromo-2-thienyl)-1-ethanone	C6H3Br2ClOS	318.407	2 / 0	3.6	Yes
70964	CHEMBL111496	C15H19N3O2S	305.396	4 / 2	2.1	Yes
73714	FASDKYOPVNHBLU-UHFFFAOYSA-N	C10H17N3S	211.327	4 / 2	1.9	Yes
76350	ondansetron	C18H19N3O	293.37	2 / 0	2.3	Yes
76868	7-iodo-1,2,3,4-tetrahydroisoquinoline	C9H10IN	259.09	1 / 1	2.2	Yes
83186	2-CHLORO-1-(4-CHLORO-3-THIENYL)-ETHANONE	C6H4Cl2OS	195.057	2 / 0	2.5	Yes
86625	2-methyl-N-[2-methyl-1-(phenylcarbonyl)-1,2,3,4-tetrahydroquinolin-4-yl]-N-phenylpropanamide	C27H28N2O2	412.533	2 / 0	5.4	No
87060	QUINPIROLE	C13H21N3	219.332	2 / 1	2.3	Yes
87186	SCHEMBL7097480	C14H17N3O2S	291.369	4 / 2	1.7	Yes
87188	CHEMBL111554	C14H17N3O2S	291.369	4 / 2	1.7	Yes
88069	CHEMBL111463	C15H19N3O2S	305.396	4 / 1	1.9	Yes
88572	CHEMBL215188	C23H26ClNO5	431.913	6 / 2	N/A	N/A
90842	CHEMBL205550	C22H32N4O4S2	480.642	8 / 2	2.6	Yes
93954	CHEMBL210537	C23H32N4O3S	444.594	6 / 2	2.8	Yes
95163	CHEMBL425522	C12H14F4N2O2S	326.31	8 / 2	1.8	Yes
95164	CHEMBL178695	C12H14F4N2O2S	326.31	8 / 2	1.8	Yes
98182	Chloromethyl Thienyl Ketone deriv. 9	C9H8Cl2O2S	251.121	3 / 0	2.9	Yes
98235	clonidine	C9H9Cl2N3	230.092	1 / 2	1.6	Yes
99162	CHEMBL571046	C19H19FN6	350.401	5 / 1	2.9	Yes
103739	akuammigine	C21H24N2O3	352.434	4 / 1	2.7	Yes
103746	.delta.-Yohimbine	C21H24N2O3	352.434	4 / 1	2.7	Yes
107391	CHEMBL435218	C23H25Cl2N3O2	446.372	4 / 1	5.5	No
108597	WB-4101	C19H23NO5	345.395	6 / 1	2.9	Yes
110475	CHEMBL2333732	C20H21ClN4O	368.865	4 / 1	3.6	Yes
114025	Roxindole	C23H26N2O	346.474	2 / 2	4.6	Yes
121366	2-Methoxyidazoxan	C12H14N2O3	234.255	4 / 1	0.5	Yes
124412	CHEMBL104985	C14H18ClN3O	279.768	4 / 0	3.4	Yes
124724	CHEMBL334529	C24H33NO3S	415.592	4 / 0	5.2	No
128267	CHEMBL379364	C25H36N4O3S	472.648	6 / 2	3.8	Yes
128301	8,9-dichloro-2,3,4,5-tetrahydro-1H-2-benzazepine	C10H11Cl2N	216.105	1 / 1	2.9	Yes
131363	prazosin	C19H21N5O4	383.408	8 / 1	2.0	Yes
135580	CHEMBL384677	C21H34N4O3S	422.588	6 / 1	1.9	Yes
137156	CHEMBL127400	C25H30N4O2	418.541	5 / 1	4.0	Yes
140407	CHEMBL125916	C24H30N4O2	406.53	4 / 2	4.0	Yes
146687	RS 67333	C19H29ClN2O2	352.903	4 / 1	3.8	Yes
147716	NAXAGOLIDE	C15H21NO2	247.338	3 / 1	2.4	Yes
155669	terguride	C20H28N4O	340.471	2 / 2	2.5	Yes
156056	CHEMBL209459	C25H34N4O3S	470.632	6 / 2	3.2	Yes
157398	CHEMBL217469	C22H24ClNO4	401.887	5 / 2	N/A	N/A
157409	CHEMBL439346	C22H24ClNO4	401.887	5 / 2	N/A	N/A
157943	CHEMBL361203	C10H13FN2O2S	244.284	5 / 2	0.3	Yes
157944	CHEMBL95873	C10H13FN2O2S	244.284	5 / 2	0.3	Yes
158017	2-chloro-1-(5-chlorothiophen-2-yl)ethanone	C6H4Cl2OS	195.057	2 / 0	3.2	Yes
160844	Spiroxatrine	C22H25N3O3	379.46	5 / 1	3.1	Yes
161693	TL99	C12H18NO2+	208.281	2 / 3	2.0	Yes
163814	13668-93-4	C6H3Cl3OS	229.499	2 / 0	3.8	Yes
164321	CHEMBL214986	C19H24ClNO5	381.853	6 / 2	N/A	N/A
164325	CHEMBL215421	C19H24ClNO5	381.853	6 / 2	N/A	N/A
174313	NCGC00167821-01	C26H37N5O2	451.615	4 / 2	3.4	Yes
176959	CHEMBL211012	C25H40N4O3S	476.68	6 / 1	3.4	Yes
181474	GSK-3beta Inhibitor VI	C6H3Br2ClOS	318.407	2 / 0	4.0	Yes
190090	L-741,626	C20H21ClN2O	340.851	2 / 2	3.7	Yes
190227	Faldaprevir	C40H49BrN6O9S	869.829	12 / 4	6.4	No
190367	1-(5-bromothiophen-2-yl)-2-chloroethanone	C6H4BrClOS	239.511	2 / 0	3.3	Yes
201789	SK&F-104078	C16H22ClNO	279.808	2 / 0	4.4	Yes
205518	CHEMBL597601	C20H21ClN4	352.866	3 / 0	3.9	Yes
209178	CHEMBL210874	C24H31FN4O3S	474.595	7 / 1	2.7	Yes
209210	Chloromethyl Thienyl Ketone deriv. 5	C6H2BrCl3OS	308.395	2 / 0	4.5	Yes
209660	BP 897	C26H31N3O2	417.553	4 / 1	4.8	Yes
212197	AC1NKXXY	C17H19N3O	281.359	2 / 2	3.3	Yes
212496	SC-52491	C16H20ClN3O2	321.805	4 / 2	1.7	Yes
217990	2-bromo-1-(4,5-dibromothiophen-2-yl)ethanone	C6H3Br3OS	362.861	2 / 0	4.1	Yes
219976	Cilansetron	C20H21N3O	319.408	2 / 0	2.6	Yes
219988	Imidazol-1-yl compound 1	C20H21N3O	319.408	2 / 0	2.6	Yes
225974	CHEMBL10161	C25H26ClN5O2	463.966	6 / 0	4.7	Yes
229273	Chloromethyl Thienyl Ketone deriv. 7	C8H6Cl2O2S	237.094	3 / 0	2.5	Yes
241416	CHEMBL523716	C17H19FN6O	342.378	6 / 2	2.4	Yes
247638	piribedil	C16H18N4O2	298.346	6 / 0	1.8	Yes
249104	D0V8NS	C25H30N2O3	406.526	5 / 0	4.2	Yes

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417