Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	D(2) dopamine receptor
Species	Homo sapiens (Human)
Gene	DRD2
Synonym	dopamine receptor 2 Dopamine D2 receptor D2R D2A and D_2B D2(415) and D₂₍₄₄₄₎ D2 receptor [ Show all ]
Disease	Substance dependence Major depressive disorder Maintain blood pressure in hypotensive states Insomnia Inflammatory disease Inflammatory bowel disease Idiopathic thrombocytopenic purpura Hypertension; Angina pectoris Hypertension Hyperprolactinemia Huntington's disease Glaucoma Gastrointestinal problems Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension Migraine headaches Nasal congestion Sexual dysfunction Schizophrenia; Schizoaffective disorders Schizophrenia; Bipolar disorder Schizophrenia Psychotic disorders Psychosis Postpartum haemorrhage Peripheral vasoconstriction; Pulmonary hypertension Parkinson's disease Pain; Inflammatory diseases Ophthalmic disease Non-small cell lung cancer Nausea; Vomiting Fibrosis False perceptions; Bipolar disorder Emesis Chronic obstructive pulmonary disease Cerebrovascular ischaemia Cardiotonic Cardiac failure Bacterial infections Breast cancer Bipolar disorder; Schizophrenia Bipolar disorder Corneal vascularity; Hyperaemia; Itching Asthma; Bronchitis Anxiety disorder Carcinoid syndrome; Acromegaly Advanced stage Parkinson's disease Dermal necrosis Depressive fatigue Alcohol use disorders Allergy Alzheimer disease Hypotension [ Show all ]
Length	443
Amino acid sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
UniProt	P14416
Protein Data Bank	6cm4, 6c38
GPCR-HGmod model	P14416
3D structure model	This structure is from PDB ID 6cm4.
BioLiP	BL0408379, BL0403379
Therapeutic Target Database	T67162
ChEMBL	CHEMBL217
IUPHAR	215
DrugBank	BE0000756

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
88	Eticlopride	C17H25ClN2O3	340.848	4 / 2	3.1	Yes
96	AC1O8PYY	C17H25ClN2O3	340.848	4 / 2	3.1	Yes
123	CHEMBL1256170	C41H45NO	567.817	2 / 0	9.2	No
224	CHEMBL169322	C18H25NO2	287.403	3 / 0	3.2	Yes
226	CHEMBL379286	C33H29Cl2N5O3	614.527	6 / 1	6.2	No
379	CHEMBL321223	C38H30BrN3O6S	736.637	8 / 5	6.7	No
393	CHEMBL1080117	C27H28ClN5S	490.066	5 / 0	5.5	No
441687	CHEMBL3394262	C40H48N14O6	820.916	18 / 5	N/A	No
535912	CHEMBL3958494	C22H27N5OS	409.552	6 / 0	3.3	Yes
535915	CHEMBL3913062	C22H27N5OS	409.552	6 / 0	3.3	Yes
535917	CHEMBL3983937	C22H27N5OS	409.552	6 / 0	3.3	Yes
535922	CHEMBL3901211	C22H27N5OS	409.552	6 / 0	3.3	Yes
474	CHEMBL373873	C25H30Cl2N6O	501.456	5 / 1	4.9	No
632	CHEMBL1258494	C24H33N3O2	395.547	4 / 1	4.2	Yes
521460	CHEMBL3818128	C19H23ClFN	319.848	2 / 1	N/A	N/A
793	CHEMBL1934127	C28H28ClN3O	458.002	2 / 2	5.4	No
942	CHEMBL233404	C24H26N2O	358.485	2 / 1	4.9	Yes
986	CHEMBL221681	C24H28BrN3O3	486.41	5 / 1	4.9	Yes
1018	CHEMBL2205816	C18H20N2O	280.371	3 / 1	1.8	Yes
1048	CHEMBL270853	C30H34N6OS	526.703	6 / 0	4.4	No
1062	CHEMBL2420770	C15H17FN2S	276.373	4 / 0	3.2	Yes
1094	CHEMBL105512	C13H23N3S	253.408	4 / 1	3.2	Yes
1188	CHEMBL2059319	C24H27FN4O2	422.504	4 / 1	3.9	Yes
441713	CHEMBL3394272	C19H27N3O3	345.443	4 / 1	1.6	Yes
1257	CHEMBL256659	C22H23F3N6O2S	492.521	11 / 0	3.9	No
1282	CHEMBL398480	C13H17NO2	219.284	3 / 1	2.1	Yes
1300	Tetrahydropapaveroline	C16H17NO4	287.315	5 / 5	1.9	Yes
1453	CHEMBL457025	C25H35N3O	393.575	4 / 1	4.8	Yes
535950	CHEMBL457024	C25H35N3O	393.575	4 / 1	4.8	Yes
1460	CHEMBL250552	C25H35N3O	393.575	4 / 1	4.8	Yes
1504	CHEMBL1257447	C22H27N5OS	409.552	6 / 0	3.5	Yes
1583	CHEMBL207543	C22H26Cl2N6	445.392	5 / 0	4.3	Yes
521490	CHEMBL3781035	C25H33NO4	411.542	5 / 1	5.2	No
1638	CHEMBL1259079	C26H28N2S	400.584	3 / 0	5.7	No
1656	CHEMBL210461	C31H35Cl2N3O	536.541	3 / 1	7.3	No
535957	CHEMBL3940897	C23H25F3N6S	474.55	9 / 0	3.3	Yes
535958	CHEMBL3939830	C23H25F3N6S	474.55	9 / 0	3.3	Yes
1841	CHEMBL272694	C29H32N6OS	512.676	7 / 0	5.6	No
441742	CHEMBL329566	C20H23NO	293.41	2 / 0	3.6	Yes
1925	CHEMBL371352	C20H23NO	293.41	2 / 0	3.6	Yes
1932	CHEMBL542148	C14H17NO2	231.295	3 / 0	2.0	Yes
1965	CHEMBL484356	C23H24BrNO2	426.354	3 / 4	N/A	N/A
1967	TANDOSPIRONE HYDROCHLORIDE	C21H30ClN5O2	419.954	6 / 1	N/A	N/A
1981	CHEMBL128232	C18H23NO2	285.387	3 / 1	3.9	Yes
2000	CHEMBL574700	C36H46N6O3	610.803	8 / 2	5.4	No
2035	CHEMBL2016619	C50H62Cl2N10O2	906.014	8 / 2	10.1	No
2047	CHEMBL252818	C24H28N4OS	420.575	5 / 1	4.1	Yes
2098	CHEMBL558838	C21H28N6O	380.496	6 / 1	2.9	Yes
2106	CHEMBL337696	C20H24N2O7S	436.479	9 / 4	N/A	N/A
2186	CHEMBL458002	C29H28ClN5O2	514.026	5 / 2	4.3	No
2284	1-(cyclohexylmethyl)pyrrolidine	C11H21N	167.296	1 / 0	3.1	Yes
2404	CHEMBL425069	C27H28ClN5O3	506.003	6 / 1	4.3	No
2954	CHEMBL540799	C24H25ClFNO3	429.916	5 / 1	N/A	N/A
441836	CHEMBL3353895	C23H29N5O	391.519	5 / 0	4.0	Yes
521530	CHEMBL3818805	C24H27ClN4O	422.957	2 / 2	4.8	Yes
3139	AC1N0YGA	C3H7NO4S	153.152	5 / 2	-4.7	Yes
3163	CHEMBL175586	C19H20F3NO2S	383.429	6 / 0	4.2	Yes
547931	CHEMBL3941102	C28H31F3N4O2	512.577	8 / 1	3.9	No
3283	CHEMBL263058	C23H28IN3O6	569.396	8 / 3	N/A	No
3349	CHEMBL92713	C21H26ClN3O2	387.908	4 / 1	3.8	Yes
3382	SCHEMBL6820733	C21H23F3N4S	420.498	6 / 2	4.3	Yes
3405	CHEMBL1642882	C18H19ClN4O2S	390.886	5 / 3	3.4	Yes
521541	CHEMBL3742207	C22H26ClN5O	411.934	6 / 1	5.1	No
3462	CHEMBL201177	C21H24N2	304.437	1 / 1	4.6	Yes
3468	CHEMBL80711	C26H32N4O6	496.564	9 / 3	N/A	N/A
3489	CHEMBL134843	C17H25NO6	339.388	7 / 4	N/A	N/A
3575	CHEMBL238915	C21H24ClN3O3S	433.951	5 / 0	3.6	Yes
3598	2-Phenylcyclopropanamine	C9H11N	133.194	1 / 1	1.5	Yes
3650	CHEMBL269396	C21H22ClN	323.864	1 / 0	6.1	No
521545	CHEMBL3774425	C23H26F3N7S	489.565	10 / 0	3.2	Yes
463329	CHEMBL3597637	C25H29ClN4O2	452.983	5 / 1	4.4	Yes
3742	tetrahydropalmatine	C21H25NO4	355.434	5 / 0	3.2	Yes
3747	D-Tetrahydropalmatine	C21H25NO4	355.434	5 / 0	3.2	Yes
3756	CHEMBL553082	C19H20N2O3	324.38	5 / 0	2.5	Yes
3773	CHEMBL332178	C19H21NO	279.383	2 / 0	3.3	Yes
3793	CHEMBL60185	C19H20N2O	292.382	2 / 2	3.5	Yes
3838	CHEMBL1257214	C23H28FN5S2	457.63	7 / 0	4.6	Yes
3896	CHEMBL239917	C22H26ClN3O	383.92	3 / 0	3.9	Yes
3929	CHEMBL1079480	C23H25F3N6S	474.55	9 / 0	3.4	Yes
4078	CHEMBL108289	C24H21ClN2O2	404.894	3 / 0	5.8	No
4244	CHEMBL301475	C25H26F3N3O4S	521.555	8 / 2	4.8	No
4259	CHEMBL116233	C25H28N2O5	436.508	6 / 3	N/A	N/A
4271	CHEMBL104135	C15H25NS	251.432	2 / 0	4.4	Yes
4476	CHEMBL538977	C23H26N4O3	406.486	6 / 0	4.5	Yes
521578	CHEMBL3797876	C17H21NO5	319.357	6 / 4	1.6	Yes
521587	CHEMBL3799593	C17H21NO5	319.357	6 / 4	1.6	Yes
4609	CHEMBL1258493	C24H31N5O2S	453.605	7 / 0	4.0	Yes
4612	CHEMBL2159474	C16H17Cl3N2O3S2	455.793	6 / 1	5.0	Yes
4657	120-78-5	C14H8N2S4	332.472	6 / 0	5.6	No
4687	Moperone	C22H26FNO2	355.453	4 / 1	3.0	Yes
4826	CHEMBL232206	C29H26F3N5S	533.617	9 / 0	6.2	No
4891	CHEMBL270376	C23H25F3N6OS2	522.609	11 / 0	4.9	No
4957	5HT6-ligand-1	C20H22BrN3O2S	448.379	4 / 0	3.6	Yes
5029	CHEMBL211135	C17H17Cl2N5	362.258	4 / 0	3.4	Yes
5045	CHEMBL397112	C19H12ClF2NO2S	391.817	5 / 0	4.8	Yes
521609	CHEMBL3764191	C21H23F3N4OS2	468.557	9 / 0	4.0	Yes
5113	CHEMBL338938	C25H35N3O2	409.574	3 / 1	4.7	Yes
5237	CHEMBL196744	C21H24Cl2FN3O	424.341	4 / 1	4.9	Yes
5245	SB-258719	C18H30N2O2S	338.51	4 / 0	3.5	Yes
5366	CHEMBL396560	C21H24N2O	320.436	2 / 1	4.3	Yes

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417