Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	D(2) dopamine receptor
Species	Homo sapiens (Human)
Gene	DRD2
Synonym	dopamine receptor 2 Dopamine D2 receptor D2R D2A and D_2B D2(415) and D₂₍₄₄₄₎ D2 receptor [ Show all ]
Disease	Substance dependence Major depressive disorder Maintain blood pressure in hypotensive states Insomnia Inflammatory disease Inflammatory bowel disease Idiopathic thrombocytopenic purpura Hypertension; Angina pectoris Hypertension Hyperprolactinemia Huntington's disease Glaucoma Gastrointestinal problems Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension Migraine headaches Nasal congestion Sexual dysfunction Schizophrenia; Schizoaffective disorders Schizophrenia; Bipolar disorder Schizophrenia Psychotic disorders Psychosis Postpartum haemorrhage Peripheral vasoconstriction; Pulmonary hypertension Parkinson's disease Pain; Inflammatory diseases Ophthalmic disease Non-small cell lung cancer Nausea; Vomiting Fibrosis False perceptions; Bipolar disorder Emesis Chronic obstructive pulmonary disease Cerebrovascular ischaemia Cardiotonic Cardiac failure Bacterial infections Breast cancer Bipolar disorder; Schizophrenia Bipolar disorder Corneal vascularity; Hyperaemia; Itching Asthma; Bronchitis Anxiety disorder Carcinoid syndrome; Acromegaly Advanced stage Parkinson's disease Dermal necrosis Depressive fatigue Alcohol use disorders Allergy Alzheimer disease Hypotension [ Show all ]
Length	443
Amino acid sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
UniProt	P14416
Protein Data Bank	6cm4, 6c38
GPCR-HGmod model	P14416
3D structure model	This structure is from PDB ID 6cm4.
BioLiP	BL0408379, BL0403379
Therapeutic Target Database	T67162
ChEMBL	CHEMBL217
IUPHAR	215
DrugBank	BE0000756

Ligand

Name	2-Phenylcyclopropanamine
Molecular formula	C9H11N
IUPAC name	2-phenylcyclopropan-1-amine
Molecular weight	133.194
Hydrogen bond acceptor	1
Hydrogen bond donor	1
XlogP	1.5
Synonyms	KBio2_002078 Lopac0_001013 NSC-80664 (-)-Tranylcypromine Racemic Tranylcypromine (2S)-2-phenylcyclopropan-1-amine SmithKline Brand of Tranylcypromine Sulfate trans 2 Phenylcyclopropylamine Allphar Brand of Tranylcypromine Sulfate tranylcypromine US8609708, 6 Tranyl- cypromine Cyclopropylamine, trans-(.+-.)- F2173-0870 Goldshield Brand of Tranylcypromine Sulfate KBio3_001876 NCGC00015848-02 Parnate (.+/-.)-Tranylcypromine SCHEMBL40651 2-PCPA Spectrum5_001829 AC1L1KJT trans-DL-2-Phenylcyclopropylamine BS-13286 Tranylcypromine,(+) Cyclopropanamine, 2-phenyl- DB00752 Jatrosom l-Tranylcypromine NCGC00162316-01 (+/-)-trans-2-phenylcyclopropylamine Parnitene (1S)-2-phenylcyclopropan-1-amine SKF Trans-385 Tranilcipromina AELCINSCMGFISI-UHFFFAOYSA-N Transapin (TN) CCRIS 3344 Tranylcyprominum [INN-Latin] Cyclopropanamine, trans-(.+-.)- EN300-54719 KBio2_004646 LS-58824 NSC80664 (.+/-.)-trans-2-Phenylcyclopropamine SBB084038 Spectrum3_001068 54-97-7 trans-(-)-2-Phenylcyclopropanamine BDBM50113851 Tranylcypromine (INN) CHEMBL313833 US8609708, 6 Tranylcypromine Cyclopropylamine, trans-2-phenyl- GJZ GTPL5281 KBioGR_001658 NCGC00015848-03 (+)-trans-2-Phenylcyclopropylamine Parnate (Salt/Mix) (1R,2S)-2-phenylcyclopropan-1-amine Sicoton (TN) 2-Phenyl-cyclopropylamine Spectrum_001598 AC1Q1HO9 Transamine C9H11N Tranylcypromine,(-) Cyclopropanamine, 2-phenyl-, (1R-trans)-(9CI) dl-Tranylcypromine Jatrosom (TN) Link Brand of Tranylcypromine Sulfate NSC 80664 (+/-)-Tranylcypromine Parstelin (TN) (1S,2S)-2-phenylcyclopropan-1-amine SKF-trans-385 2-phenylcyclopropylamine Tranilcipromina [INN-Spanish] AKOS005217104 Tranylcypromin CHEBI:131512 Tylciprine (TN) Cyclopropylamine, 2-phenyl-, trans-(+-)- esparma Brand of Tranylcypromine Sulfate GlaxoSmithKline Brand of Tranylcypromine Sulfate KBio2_007214 MCULE-7015811838 Parmodalin (TN) (.+/-.)-trans-2-Phenylcyclopropylamine SC-66350 2- Amino-cyclopropylbenzene Spectrum4_001219 AB01007711-01 trans-2-Phenylcyclopropylamine BRN 3195803 Tranylcypromine [INN:BAN] CTK1F7780 D0H0HJ HSDB 3404 KBioSS_002078 NCGC00015848-04 (+)-Tranylcypromine Parnate (TN) (1R,2R)-2-phenylcyclopropan-1-amine SKF 385 2-phenylcyclopropan-1-amine Sulfate, Tranylcypromine AC1Q53BI Transamine (TN) CCG-40399 Tranylcyprominum Cyclopropanamine, 2-phenyl-, trans-(+-)- EINECS 205-841-9 [ Show all ]
Inchi Key	AELCINSCMGFISI-UHFFFAOYSA-N
Inchi ID	InChI=1S/C9H11N/c10-9-6-8(9)7-4-2-1-3-5-7/h1-5,8-9H,6,10H2
PubChem CID	5530
ChEMBL	CHEMBL313833
IUPHAR	N/A
BindingDB	50113851
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	<10000.0 nM	PMID9686407	PDSP,BindingDB

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417