Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●ATGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●TM-search ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●rMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●HPmod ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Endothelin-1 receptor
Species	Homo sapiens (Human)
Gene	EDNRA
Synonym	ET-A ETA-R hET-AR ETA receptor ENDOR endothelin A receptor Endothelin receptor type A {ECO:0000312\|HGNC:HGNC:3179} ET-AR endothelin-1 receptor Gpcr10 [ Show all ]
Disease	Vasospasm following subarachnoid hemorrhage Hormone refractory prostate cancer Hormone resistant prostate cancer Hypertension Hypotension Nerve injury Premature labour Prostate cancer Pulmonary arterial hypertension Pulmonary hypertension Solid tumours Unspecified Heart disease Cerebrovascular disorders Diabetic nephropathy [ Show all ]
Length	427
Amino acid sequence	METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
UniProt	P25101
Protein Data Bank	N/A
GPCR-HGmod model	P25101
3D structure model	This predicted structure model is from GPCR-EXP P25101.
BioLiP	N/A
Therapeutic Target Database	T23499
ChEMBL	CHEMBL252
IUPHAR	219
DrugBank	BE0000521

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
266	CHEMBL329744	C30H36N4O5	532.641	8 / 2	2.5	No
439	CHEMBL31662	C27H22O5	426.468	5 / 2	4.5	Yes
1162	CHEMBL10781	C29H28O10	536.533	10 / 1	3.9	No
1701	CHEMBL103001	C24H21NO5	403.434	6 / 1	3.8	Yes
2389	CHEMBL2165330	C24H22BrClN6O6S	637.89	12 / 2	4.1	No
2923	CHEMBL540049	C16H28ClN2O4P	378.834	6 / 2	N/A	N/A
2933	CHEMBL94438	C30H26F2N4O4	544.559	9 / 2	2.1	No
3292	CHEMBL47868	C29H29NO10	551.548	11 / 2	1.7	No
3294	CHEMBL298664	C29H29NO10	551.548	11 / 2	1.7	No
3362	CHEMBL367444	C29H33N5O7S3	659.791	13 / 2	4.9	No
3377	CHEMBL9139	C27H34N2O6	482.577	7 / 1	1.7	Yes
3572	CHEMBL545490	C13H17ClN2O	252.742	3 / 1	N/A	N/A
4671	CHEMBL10860	C28H21NO6	467.477	7 / 1	4.3	Yes
5290	CHEMBL316523	C37H41NO12	691.73	12 / 1	6.4	No
5467	CHEMBL348685	C20H22N2O3S2	402.527	6 / 1	4.6	Yes
5830	CHEMBL70924	C30H34N6O6S	606.698	10 / 3	4.9	No
6226	CHEMBL306218	C21H20N2O4	364.401	6 / 1	3.4	Yes
6282	CHEMBL102825	C23H19NO5	389.407	6 / 1	3.4	Yes
6514	CHEMBL147238	C22H19N3O4S	421.471	6 / 1	3.2	Yes
6578	CHEMBL9141	C24H28N2O6	440.496	7 / 2	0.6	Yes
6617	carbachol	C6H15ClN2O2	182.648	3 / 1	N/A	N/A
6824	CHEMBL303743	C21H22ClN3O6S2	511.992	9 / 2	3.9	No
7104	CHEMBL92612	C22H20N4O4	404.426	7 / 2	-0.4	Yes
7802	CHEMBL545738	C12H14ClFN2O	256.705	4 / 1	N/A	N/A
8293	CHEMBL544331	C15H21ClN2O4	328.793	6 / 1	N/A	N/A
8440	CHEMBL274370	C24H19NO6	417.417	6 / 1	4.9	Yes
8624	CHEMBL94525	C50H66N8O10	939.124	11 / 10	2.3	No
9307	CHEMBL319679	C33H29NO4	503.598	5 / 0	8.0	No
9403	CHEMBL316247	C29H25N3O4	479.536	5 / 2	5.3	No
9864	AC-42	C20H31NO	301.474	2 / 0	5.2	No
9914	CHEMBL343785	C21H22ClN3O6S2	511.992	9 / 2	3.9	No
10238	CHEMBL414082	C55H73N7O10	992.228	10 / 9	8.2	No
10367	CHEMBL296927	C20H18ClN3O8S2	527.947	11 / 2	3.1	No
10418	CHEMBL281977	C32H29N5O5S	595.674	8 / 1	5.1	No
11425	CHEMBL123997	C32H36N2O6	544.648	7 / 2	3.4	No
11624	CHEMBL102969	C27H27NO5	445.515	6 / 1	5.1	No
521787	propranolol	C16H21NO2	259.349	3 / 2	3.0	Yes
11838	CHEMBL146845	C24H31N3O3S	441.59	6 / 2	6.1	No
12289	CHEMBL275701	C28H26O9	506.507	9 / 1	4.0	No
12372	CHEMBL368945	C31H29N5O9S3	711.779	15 / 2	4.9	No
12415	CHEMBL416518	C24H17NO6	415.401	6 / 1	4.7	Yes
12418	CHEMBL2163720	C25H27BrN8O6S	647.505	14 / 2	3.2	No
12714	CHEMBL450628	C27H31N5O4	489.576	8 / 2	0.4	Yes
12823	CHEMBL541312	C20H25ClN2O2	360.882	4 / 1	N/A	N/A
12877	CHEMBL286682	C14H19N3O3S	309.384	6 / 2	2.6	Yes
13421	CHEMBL323331	C51H67N7O10	938.136	10 / 9	6.6	No
13539	CHEMBL172030	C31H32N6O7S3	696.812	14 / 2	5.2	No
13718	CHEMBL1271640	C32H31NO8	557.599	9 / 2	6.3	No
13892	5-Bromo-N,N-dimethyltryptamine	C12H15BrN2	267.17	1 / 1	2.2	Yes
14948	CHEMBL330135	C34H34ClFN4O4	617.118	8 / 2	4.5	No
15336	CHEMBL266684	C17H16IN3O2S	453.298	5 / 1	3.7	Yes
15620	CHEMBL103501	C34H29NO7	563.606	7 / 1	6.3	No
15657	SCHEMBL5351769	C26H24N6O5	500.515	10 / 3	-0.5	No
15770	CHEMBL332109	C38H37F3N2O8	706.715	12 / 3	N/A	No
15862	CHEMBL43788	C17H16ClN3O6S2	457.9	9 / 2	3.0	Yes
16367	CHEMBL432815	C19H21BrN2O3S2	469.412	6 / 1	5.9	No
16568	CHEMBL23418	C30H30N2O7S	562.637	7 / 1	5.1	No
16660	CHEMBL274489	C27H30N4O5S	522.62	8 / 1	4.7	No
16894	CHEMBL6543	C18H19BrN4O2S	435.34	6 / 1	3.9	Yes
16912	CID 57486785	C8H14BrNO2	236.109	3 / 1	N/A	N/A
17105	CHEMBL96114	C32H32N4O4	536.632	7 / 2	2.7	No
17133	CHEMBL2440659	C15H11FN4O2S	330.337	7 / 1	2.4	Yes
521989	CHEMBL3735236	C37H45N7O4S	683.872	9 / 2	5.4	No
17658	CHEMBL1627022	C27H27BrN5NaO5S	636.497	10 / 1	N/A	No
18021	CHEMBL424101	C19H20ClN3O5S2	469.955	8 / 3	3.3	Yes
18582	CHEMBL359273	C21H18N4O3S	406.46	7 / 1	3.6	Yes
18736	CHEMBL149050	C20H22N2O5S2	434.525	7 / 1	3.4	Yes
19173	CHEMBL61211	C27H24O7	460.482	7 / 1	4.9	Yes
19651	CHEMBL434082	C21H24N2O3S	384.494	5 / 1	5.2	No
20155	CHEMBL65939	C31H31NO7	529.589	8 / 1	4.5	No
20388	CHEMBL2163722	C25H25BrN8O7S	661.488	15 / 1	1.8	No
20438	CHEMBL172297	C31H36N4O7S3	672.83	12 / 2	6.1	No
20895	CHEMBL342615	C30H42N6O8S	646.76	8 / 6	1.6	No
20904	CHEMBL286808	C19H14O5	322.316	5 / 2	2.1	Yes
21071	CHEMBL267096	C26H24O6	432.472	6 / 1	4.2	Yes
21168	CHEMBL101292	C29H20ClNO4	481.932	5 / 0	6.9	No
21299	CHEMBL545270	C12H14Cl2N2O	273.157	3 / 1	N/A	N/A
21535	CHEMBL175057	C28H25N9O5S	599.626	13 / 2	3.2	No
21718	CHEMBL283582	C19H20ClN3O4S2	453.956	7 / 2	4.6	Yes
21765	CHEMBL269409	C29H22O6	466.489	6 / 1	5.3	No
522150	CHEMBL3775436	C15H26ClNO3	303.827	4 / 3	N/A	N/A
522183	CHEMBL3775769	C15H26ClNO3	303.827	4 / 3	N/A	N/A
22294	CHEMBL102314	C27H27NO5	445.515	6 / 1	5.0	Yes
22329	184040-74-2	C9H7ClN2O5S2	322.734	8 / 2	1.8	Yes
22723	CHEMBL47417	C18H18BrN3O4S2	484.383	7 / 2	4.3	Yes
23059	CHEMBL343578	C21H25ClN4O4S2	497.025	8 / 2	4.0	Yes
23458	CHEMBL45875	C18H18N2O4S2	390.472	7 / 1	3.6	Yes
24316	CHEMBL170335	C23H32O5	388.504	5 / 2	3.4	Yes
24458	CHEMBL2165332	C24H23BrN6O4S	571.45	10 / 2	4.0	No
24824	CHEMBL10733	C25H19ClO6	450.871	6 / 1	4.7	Yes
25431	CHEMBL41087	C24H20O6	404.418	6 / 2	4.1	Yes
25453	CHEMBL123316	C34H37F3N2O8	658.671	12 / 3	N/A	No
25617	CHEMBL343867	C20H23N3O3S	385.482	6 / 2	4.1	Yes
25765	CHEMBL122832	C29H30N2O8	534.565	9 / 2	1.2	No
25911	CHEMBL554094	C11H16ClN3O	241.719	4 / 1	N/A	N/A
25973	CHEMBL79054	C11H10Cl2N2O3S	321.172	5 / 1	2.9	Yes
26174	CHEMBL314755	C30H27FN4O4	526.568	8 / 2	2.0	No
26889	CHEMBL1271691	C32H31NO8	557.599	9 / 2	6.3	No
26958	CHEMBL276615	C23H17NO5	387.391	5 / 1	4.9	Yes
27221	CHEMBL2203713	C18H22N4S	326.462	4 / 2	2.9	Yes

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417