Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Hydroxycarboxylic acid receptor 2
Species	Mus musculus (Mouse)
Gene	Hcar2
Synonym	Protein PUMA-G Nicotinic acid receptor Nic1 Niacr1 niacin receptor 1 HCA2 receptor G-protein coupled receptor HM74A G-protein coupled receptor HM74 G-protein coupled receptor 109A G-protein coupled receptor 109 G protein-coupled receptor 109A PUMAG [ Show all ]
Disease	N/A for non-human GPCRs
Length	360
Amino acid sequence	MSKSDHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFLLIICLPFLTDNYVHNWDWRFGGIPCRVMLFMLAMNRQGSIIFLTVVAVDRYFRVVHPHHFLNKISNRTAAIISCFLWGLTIGLTVHLLYTNMMTKNGEAYLCSSFSICYNFRWHDAMFLLEFFLPLAIILFCSGRIIWSLRQRQMDRHAKIKRAINFIMVVAIVFIICFLPSVAVRIRIFWLLYKYNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPNFFSTCINRCLRKKTLGEPDNNRSTSVELTGDPSTTRSIPGALMADPSEPGSPPYLASTSR
UniProt	Q9EP66
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL4420
IUPHAR	312
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
12520	SCH-900271	C14H16N2O4	276.292	4 / 2	1.6	Yes
30297	CHEMBL519689	C14H14N6	266.308	4 / 2	1.9	Yes
31427	CHEMBL1672639	C15H16F2N2O3	310.301	6 / 1	2.7	Yes
558611	MK-6892	C19H22N4O5	386.408	8 / 3	2.3	Yes
53193	CHEMBL2036951	C11H10F2N2O4	272.208	6 / 2	0.6	Yes
58659	CHEMBL1671877	C14H14F2N2O3	296.274	6 / 1	2.3	Yes
67178	CHEMBL482943	C13H11FN6	270.271	5 / 2	1.6	Yes
75355	5932-32-1	C7H8N2O2	152.153	3 / 2	0.8	Yes
75851	CHEMBL502716	C13H11ClN6	286.723	4 / 2	2.2	Yes
101744	CHEMBL1208920	C10H14N2O2	194.234	3 / 2	2.0	Yes
102619	CHEMBL504980	C13H11FN6	270.271	5 / 2	1.6	Yes
560516	2-(3-(3-(4-hydroxyphenyl)-1,2,4-oxadiazol-5-yl)propanamido)benzoic acid	C18H15N3O5	353.334	7 / 3	2.6	Yes
116500	CHEMBL520137	C13H9F3N6	306.252	7 / 2	1.8	Yes
116665	CHEMBL2036813	C11H12N2O4	236.227	4 / 2	0.7	Yes
128698	CHEMBL1208922	C13H12N2O2	228.251	3 / 2	2.2	Yes
132115	CHEMBL1208919	C10H14N2O2	194.234	3 / 2	2.3	Yes
132473	CHEMBL483141	C13H10F2N6	288.262	6 / 2	1.7	Yes
135351	CHEMBL483142	C13H10F2N6	288.262	6 / 2	1.7	Yes
135930	CHEMBL1208921	C11H16N2O2	208.261	3 / 2	2.5	Yes
145988	CHEMBL447050	C13H11ClN6	286.723	4 / 2	2.2	Yes
148426	CHEMBL2036954	C13H14N2O4	262.265	4 / 2	1.2	Yes
169205	CHEMBL519966	C13H11FN6	270.271	5 / 2	1.6	Yes
178934	CHEMBL482979	C12H18N6	246.318	4 / 2	2.8	Yes
193895	CHEMBL485195	C13H11ClN6	286.723	4 / 2	2.2	Yes
196139	MK-0354	C7H8N6	176.183	4 / 2	0.2	Yes
196370	CHEMBL507182	C13H10F2N6	288.262	6 / 2	1.7	Yes
205766	CHEMBL519811	C13H10F2N6	288.262	6 / 2	1.7	Yes
222186	6-METHYL-1,4,5,6-TETRAHYDROCYCLOPENTAPYRAZOLE-3-CARBOXYLIC ACID	C8H10N2O2	166.18	3 / 2	1.1	Yes
228525	CHEMBL1208925	C11H10N2O2S	234.273	4 / 2	1.8	Yes
244676	CHEMBL520676	C13H10F2N6	288.262	6 / 2	1.7	Yes
262440	CHEMBL485194	C14H14N6	266.308	4 / 2	1.9	Yes
269963	nicotinic acid	C6H5NO2	123.111	3 / 1	0.4	Yes
299144	CHEMBL1208923	C13H9F3N2O2	282.222	6 / 2	2.5	Yes
299294	CHEMBL501585	C10H12N6	216.248	4 / 2	1.2	Yes
302709	CHEMBL520675	C13H12N6	252.281	4 / 2	1.5	Yes
311966	CHEMBL519338	C9H12N6	204.237	4 / 2	1.1	Yes
312505	CHEMBL1208987	C10H10N4O2	218.216	4 / 2	0.4	Yes
313136	CHEMBL1208924	C11H10N2O2S	234.273	4 / 2	1.9	Yes
347047	CHEMBL509541	C11H16N6	232.291	4 / 2	2.2	Yes
356079	CHEMBL1208988	C9H9N5O2	219.204	5 / 2	-0.2	Yes
358266	CHEMBL484172	C13H20N6	260.345	4 / 2	3.3	Yes
373068	CHEMBL500239	C10H14N6	218.264	4 / 2	1.7	Yes
555152	(R)-3-Hydroxybutanoic acid	C4H8O3	104.105	3 / 2	-0.5	Yes
404227	CHEMBL1208926	C11H12N4O2	232.243	4 / 2	0.5	Yes
411070	CHEMBL520159	C12H16N6	244.302	4 / 2	2.2	Yes
423684	CHEMBL1208986	C11H12N4O2	232.243	4 / 2	0.5	Yes

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417