Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Hydroxycarboxylic acid receptor 2
Species	Rattus norvegicus (Rat)
Gene	Hcar2
Synonym	Protein PUMA-G Nicotinic acid receptor Nic1 Niacr1 niacin receptor 1 HCA2 receptor G-protein coupled receptor HM74A G-protein coupled receptor HM74 G-protein coupled receptor 109A G-protein coupled receptor 109 G protein-coupled receptor 109A PUMAG [ Show all ]
Disease	N/A for non-human GPCRs
Length	360
Amino acid sequence	MSKQNHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFLLIICLPFLTDNYVQNWDWRFGSIPCRVMLFMLAMNRQGSIIFLTVVAVDRYFRVVHPHHFLNKISNRTAAIISCFLWGITIGLTVHLLYTDMMTRNGDANLCSSFSICYTFRWHDAMFLLEFFLPLGIILFCSGRIIWSLRQRQMDRHVKIKRAINFIMVVAIVFVICFLPSVAVRIRIFWLLYKHNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPNFFSTCINRCLRRKTLGEPDNNRSTSVELTGDPSTIRSIPGALMTDPSEPGSPPYLASTSR
UniProt	Q80Z39
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL4731
IUPHAR	312
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
7158	CHEMBL1224147	C16H14FN3O2	299.305	5 / 1	1.9	Yes
12522	SCH-900271	C14H16N2O4	276.292	4 / 2	1.6	Yes
23420	3-(4-methylphenyl)-1H-pyrazole-5-carboxylic acid	C11H10N2O2	202.213	3 / 2	2.1	Yes
31428	CHEMBL1672639	C15H16F2N2O3	310.301	6 / 1	2.7	Yes
42375	5-isopropyl-1H-pyrazole-3-carboxylic acid	C7H10N2O2	154.169	3 / 2	1.2	Yes
558612	MK-6892	C19H22N4O5	386.408	8 / 3	2.3	Yes
53191	CHEMBL2036951	C11H10F2N2O4	272.208	6 / 2	0.6	Yes
58661	CHEMBL1671877	C14H14F2N2O3	296.274	6 / 1	2.3	Yes
75356	5932-32-1	C7H8N2O2	152.153	3 / 2	0.8	Yes
112842	CHEMBL1224219	C16H14ClN3O2	315.757	4 / 1	2.4	Yes
114847	5-phenethyl-1H-pyrazole-3-carboxylic Acid	C12H12N2O2	216.24	3 / 2	2.3	Yes
116664	CHEMBL2036813	C11H12N2O4	236.227	4 / 2	0.7	Yes
145831	CHEMBL1224070	C16H14ClN3O3	331.756	5 / 1	3.0	Yes
147998	CHEMBL129326	C13H14N2O2	230.267	3 / 2	2.7	Yes
148427	CHEMBL2036954	C13H14N2O4	262.265	4 / 2	1.2	Yes
150597	CHEMBL1939049	C18H20N2O4	328.368	5 / 1	3.0	Yes
174217	1H-Pyrazole-3-carboxylic acid	C4H4N2O2	112.088	3 / 2	0.1	Yes
196138	MK-0354	C7H8N6	176.183	4 / 2	0.2	Yes
198479	4,5,6,7-Tetrahydro-1H-indazole-3-carboxylic acid	C8H10N2O2	166.18	3 / 2	1.3	Yes
204765	CHEMBL1939047	C18H20N2O4	328.368	5 / 1	3.0	Yes
218397	CHEMBL127387	C12H12N2O3	232.239	4 / 2	2.0	Yes
221989	CHEMBL2036955	C13H14N2O4	262.265	4 / 2	1.2	Yes
253057	CHEMBL503030	C6H6N2O3	154.125	4 / 2	0.1	Yes
256634	CHEMBL482768	C21H19N3O4	377.4	5 / 3	3.0	Yes
269964	nicotinic acid	C6H5NO2	123.111	3 / 1	0.4	Yes
274323	3-phenyl-1H-pyrazole-5-carboxylic acid	C10H8N2O2	188.186	3 / 2	1.7	Yes
289982	3-propyl-1H-pyrazole-5-carboxylic acid	C7H10N2O2	154.169	3 / 2	1.3	Yes
300962	CHEMBL1223819	C8H4F3N3O	215.135	6 / 1	1.1	Yes
348779	CHEMBL394441	C11H9ClN2O2	236.655	3 / 2	2.7	Yes
350710	949034-59-7	C6H6N2O3	154.125	4 / 2	-0.7	Yes
385695	5-(4-chlorophenyl)-1H-pyrazole-3-carboxylic acid	C10H7ClN2O2	222.628	3 / 2	2.4	Yes
389069	CHEMBL2036948	C12H14N2O4	250.254	4 / 2	0.9	Yes
393821	5-(3-chlorophenyl)-1H-pyrazole-3-carboxylic acid	C10H7ClN2O2	222.628	3 / 2	2.4	Yes
412355	CHEMBL341520	C11H9ClN2O2	236.655	3 / 2	2.7	Yes
420822	CHEMBL128949	C12H12N2O2	216.24	3 / 2	2.4	Yes
422133	5-benzyl-1H-pyrazole-3-carboxylic Acid	C11H10N2O2	202.213	3 / 2	2.0	Yes
430203	5-Butyl-1H-pyrazole-3-carboxylic acid	C8H12N2O2	168.196	3 / 2	1.8	Yes
432066	CHEMBL128077	C15H26N2O2	266.385	3 / 2	5.6	No

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417