Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Adenosine receptor A1
Species	Homo sapiens (Human)
Gene	ADORA1
Synonym	RDC7 A1 receptor A1-AR A1R adenosine receptor A1
Disease	Cardiac arrhythmias Hypertension Cardiac disease Cognitive disorders Diabetes Fatigue; Orthostatic hypotension Glaucoma Heart failure Autoimmune diabetes Atrial fibrillation; Cardiac arrhythmias Atrial fibrillation Sepsis Renal failure Parkinson's disease Neuropathic pain Acute and chronic heart failure Multiple scierosis Hypertriglyceridemia Allergy Asthma Hyperlipidaemia [ Show all ]
Length	326
Amino acid sequence	MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD
UniProt	P30542
Protein Data Bank	6d9h, 5n2s
GPCR-HGmod model	P30542
3D structure model	This structure is from PDB ID 6d9h.
BioLiP	BL0385576, BL0417675
Therapeutic Target Database	T88714, T92072
ChEMBL	CHEMBL226
IUPHAR	18
DrugBank	BE0000013

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
45	CHEMBL574416	C17H12N4O	288.31	3 / 1	2.7	Yes
69	Pyrimidin-4-ylacetamide, 26	C19H24N6O2	368.441	6 / 1	2.0	Yes
187	CHEMBL473650	C21H14N6O2	382.383	5 / 1	2.8	Yes
238	CHEMBL437168	C26H26ClN7O6	567.987	10 / 5	2.2	No
365	CHEMBL573125	C28H31ClN6O5	567.043	9 / 4	2.5	No
547903	CHEMBL3938269	C19H14ClN3	319.792	3 / 1	4.6	Yes
476	CHEMBL38304	C28H32N6O4	516.602	6 / 2	3.2	No
690	CHEMBL196259	C16H16N8	320.36	6 / 1	2.3	Yes
521465	CHEMBL3827623	C26H36N6O3	480.613	6 / 0	3.9	Yes
799	CHEMBL2170801	C22H30ClN5O2	431.965	6 / 3	4.2	Yes
800	CHEMBL468370	C16H11N3O	261.284	4 / 1	3.2	Yes
808	CHEMBL2089347	C27H24ClN5O2	485.972	6 / 3	4.2	Yes
829	CHEMBL382194	C18H20IN7O4	525.307	8 / 5	0.4	No
871	CHEMBL481383	C20H23N5O2	365.437	3 / 0	3.6	Yes
936	2-amino-4-(1,3-benzodioxol-5-yl)-6-methoxypyridine-3,5-dicarbonitrile	C15H10N4O3	294.27	7 / 1	2.2	Yes
991	CHEMBL1927632	C8H7N7O	217.192	7 / 2	-0.1	Yes
997	CHEMBL208311	C25H30N6O4	478.553	8 / 4	2.7	Yes
1044	Pyrimidin-4-ylacetamide, 9	C20H24N6O3	396.451	7 / 1	1.7	Yes
1091	CHEMBL609297	C15H19ClN4OS	338.854	5 / 4	N/A	N/A
1202	CHEMBL178846	C22H25ClN6O5	488.929	9 / 4	1.3	Yes
463133	CHEMBL3613140	C24H16ClN5O2S	473.935	8 / 1	5.2	No
1448	CHEMBL3121728	C27H31ClN6O3	523.034	6 / 1	3.6	No
1478	CHEMBL1650163	C18H13F2N3O	325.319	5 / 1	3.2	Yes
1546	SCHEMBL1497826	C22H20Cl3N3OS	480.832	5 / 1	6.5	No
441733	CID 118733042	C10H8N4OS	232.261	4 / 1	1.1	Yes
1715	CHEMBL1094143	C25H19N5O	405.461	4 / 1	4.6	Yes
1990	CHEMBL515442	C19H20ClIN6O5	574.76	9 / 4	1.7	No
2123	CHEMBL2112158	C21H23ClN6O3	442.904	7 / 4	1.7	Yes
2147	CHEMBL434692	C18H14BrNOS	372.28	3 / 1	5.8	No
2241	CHEMBL259178	C16H15N5O2	309.329	6 / 2	1.9	Yes
557362	CHEMBL2312720	C18H13N3O3	319.32	4 / 1	2.9	Yes
441765	CHEMBL3410319	C23H15F4N5O4	501.398	11 / 0	3.9	No
2309	CHEMBL218837	C19H20ClN7O5	461.863	9 / 5	0.9	Yes
2318	CHEMBL366216	C19H25N7	351.458	6 / 3	4.2	Yes
521525	CHEMBL3785142	C14H17NO3S	279.354	4 / 1	1.8	Yes
463233	CHEMBL3613138	C18H13N5O2S	363.395	7 / 1	4.0	Yes
2994	RWJ-68354	C19H15FN4O	334.354	5 / 2	3.3	Yes
3060	CHEMBL376920	C19H15N3	285.35	3 / 1	4.4	Yes
3106	Pyrimidin-4-ylacetamide, 6	C22H29N7O2	423.521	7 / 1	2.2	Yes
3208	SCHEMBL4154525	C17H16F3NOS	339.376	6 / 1	5.8	No
3483	CHEMBL56534	C17H11BrN2O3S	403.25	5 / 1	5.6	No
3620	CHEMBL1927430	C19H28N8O5	448.484	11 / 3	1.0	No
3674	CHEMBL490250	C17H22ClN5O4	395.844	8 / 4	2.3	Yes
3790	CHEMBL186443	C19H20N8O4	424.421	10 / 4	-0.4	Yes
3815	CHEMBL257256	C16H18ClN3O2S	351.849	5 / 1	3.9	Yes
3855	316173-57-6	C20H19N7O2	389.419	7 / 1	2.7	Yes
3959	CHEMBL2391832	C20H13N3O3S	375.402	6 / 1	3.8	Yes
4042	CHEMBL428716	C22H29N7O6	487.517	11 / 4	1.1	No
517337	SCHEMBL246621	C29H29N5O3S	527.643	8 / 2	4.1	No
4087	CHEMBL235717	C24H18ClN5O3	459.89	5 / 1	5.7	No
557400	CHEMBL3800558	C37H41N5O4	619.766	7 / 4	5.7	No
4118	CHEMBL465640	C17H11F3N4	328.298	6 / 1	4.0	Yes
4209	CHEMBL278805	C22H22Cl2N8O3S	549.431	9 / 1	2.7	No
4239	CHEMBL446264	C8H10BrN5	256.107	4 / 1	1.4	Yes
4354	CHEMBL22355	C21H17N7O5	447.411	10 / 2	2.2	Yes
4373	CHEMBL56115	C24H19NOS	369.482	3 / 1	6.8	No
4383	CHEMBL3087709	C23H17N5O2	395.422	5 / 1	3.6	Yes
4437	CHEMBL574490	C19H13Cl2N7O2	442.26	6 / 1	3.2	Yes
4514	CHEMBL575605	C31H25N7O2	527.588	6 / 1	5.4	No
4604	CHEMBL3125715	C22H29N5O2	395.507	6 / 3	3.1	Yes
4653	ethyl 2-amino-4-(3-(trifluoromethyl)phenyl)thiophene-3-carboxylate	C14H12F3NO2S	315.31	7 / 1	4.5	Yes
4684	3-(4-bromobenzoyl)-4H,5H,6H-cyclopenta[b]thiophen-2-amine	C14H12BrNOS	322.22	3 / 1	4.5	Yes
521590	871266-83-0	C11H6ClN5O2S	307.712	7 / 1	3.7	Yes
4750	CHEMBL27376	C20H20ClIN6O3	554.773	7 / 4	2.0	No
4759	CHEMBL376778	C20H19N3O	317.392	3 / 1	4.1	Yes
4816	CHEMBL1171381	C31H37N5O4	543.668	5 / 0	4.4	No
4836	CID 44327951	C15H18ClN5O3	351.791	5 / 1	1.0	Yes
4866	CHEMBL611552	C20H22N10O7	514.459	14 / 5	-0.1	No
4869	CHEMBL2413111	C20H22N10O7	514.459	14 / 5	-0.1	No
4871	CHEMBL611552	C20H22N10O7	514.459	14 / 5	-0.1	No
4877	CHEMBL1258192	C22H23N7O2	417.473	7 / 1	3.5	Yes
4933	CHEMBL255861	C20H15ClN4O3S	426.875	7 / 1	3.9	Yes
4994	CHEMBL2042308	C49H58N8O5	839.054	10 / 6	9.0	No
441903	CHEMBL1766351	C21H15ClN4O2	390.827	3 / 2	4.1	Yes
5153	CHEMBL1088665	C23H24N6O	400.486	7 / 2	2.1	Yes
5183	CHEMBL565074	C17H12INOS	405.253	3 / 1	5.4	No
5193	triazine-4-carboxamide, 6	C15H12ClN5O2	329.744	6 / 2	2.1	Yes
441908	CHEMBL3415043	C13H12N4O2S	288.325	6 / 2	2.2	Yes
463517	CHEMBL3612943	C20H20ClN9O3S	501.95	10 / 4	1.0	No
5374	CHEMBL3093315	C17H17N5O2S	355.416	5 / 0	1.4	Yes
5610	UNII-29S2U9DRGS	C27H28N6O5	516.558	8 / 1	5.7	No
5625	CHEMBL589513	C43H56ClN11O7S	906.501	12 / 9	1.2	No
5627	CHEMBL583748	C43H56ClN11O7S	906.501	12 / 9	1.2	No
5633	2-(1-hexynyl)adenosine	C16H21N5O4	347.375	8 / 4	1.3	Yes
5788	CHEMBL108552	C25H31FN4O5S	518.604	7 / 1	5.8	No
521628	CHEMBL3799847	C20H18ClN5O4S	459.905	8 / 3	1.6	Yes
5906	CHEMBL574352	C13H12N4O	240.266	3 / 1	1.4	Yes
5958	CHEMBL220386	C21H21FN6O5	456.434	10 / 4	1.3	Yes
5989	CHEMBL595981	C25H32ClN3O5S	522.057	7 / 1	4.9	No
6068	CHEMBL255649	C20H16N4O3S	392.433	7 / 1	3.3	Yes
463628	CHEMBL3613133	C25H19N5O2S2	485.58	9 / 1	5.1	No
6392	triazine-4-carboxamide, 13	C15H14N6O2	310.317	7 / 2	0.8	Yes
6462	CHEMBL208530	C12H17N7O4	323.313	8 / 5	-1.0	Yes
441942	CHEMBL3314874	C27H26N6O4	498.543	8 / 2	3.8	Yes
441945	CHEMBL3410309	C19H21N5O3	367.409	6 / 1	3.0	Yes
6504	CHEMBL142926	C23H22N8O3	458.482	7 / 2	3.3	Yes
463670	CHEMBL3581311	C19H26N10O	410.486	7 / 2	1.1	Yes
6699	CHEMBL210642	C18H16N6O3	364.365	6 / 2	1.2	Yes
6734	MRS 1754	C26H26N6O4	486.532	6 / 2	4.9	Yes
6821	CHEMBL90298	C19H23N5O3	369.425	4 / 2	3.4	Yes

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417