Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●ATGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●TM-search ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●rMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●HPmod ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Hydroxycarboxylic acid receptor 3
Species	Homo sapiens (Human)
Gene	HCAR3
Synonym	G-protein coupled receptor 109B Nicotinic acid receptor 2 Nic2 NIACR2 Niacin receptor 2 Low affinity nicotinic acid receptor G protein-coupled receptor 109B G-protein coupled receptor HM74B G-protein coupled receptor HM74 HCA3 receptor [ Show all ]
Disease	N/A
Length	387
Amino acid sequence	MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNWTAAIISCLLWGITVGLTVHLLKKKLLIQNGTANVCISFSICHTFRWHEAMFLLEFFLPLGIILFCSARIIWSLRQRQMDRHAKIKRAITFIMVVAIVFVICFLPSVVVRIHIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPSFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE
UniProt	P49019
Protein Data Bank	N/A
GPCR-HGmod model	P49019
3D structure model	This predicted structure model is from GPCR-EXP P49019.
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL4421
IUPHAR	313
DrugBank	BE0000836

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
27	6-n-butylamino-3-pyridine carboxylic acid	C10H14N2O2	194.234	4 / 2	1.9	Yes
1642	4-(dipropylamino)-3-nitrobenzoic acid	C13H18N2O4	266.297	5 / 1	3.2	Yes
3249	CHEMBL238385	C10H14N2O3	210.233	5 / 2	1.0	Yes
3760	CHEMBL3299115	C18H19NO5	329.352	5 / 2	2.8	Yes
5529	CHEMBL559204	C14H13N3O2S2	319.397	6 / 2	2.9	Yes
7159	CHEMBL1224147	C16H14FN3O2	299.305	5 / 1	1.9	Yes
7288	CHEMBL238387	C10H14N2O2	194.234	4 / 1	1.7	Yes
8634	CHEMBL223700	C12H8F2O4	254.189	6 / 1	1.9	Yes
12519	SCH-900271	C14H16N2O4	276.292	4 / 2	1.6	Yes
17160	1-cyclobutyl-1H-benzotriazole-5-carboxylic acid	C11H11N3O2	217.228	4 / 1	1.8	Yes
18409	CHEMBL385103	C12H8F2O4	254.189	6 / 1	1.9	Yes
25523	6-(cyclopropylamino)pyridine-3-carboxylic acid	C9H10N2O2	178.191	4 / 2	1.3	Yes
31430	CHEMBL1672639	C15H16F2N2O3	310.301	6 / 1	2.7	Yes
32001	CHEMBL202206	C11H13N3O2	219.244	4 / 1	1.8	Yes
32714	CHEMBL238375	C11H14N2O4	238.243	5 / 1	2.3	Yes
35419	CHEMBL560254	C10H17N3O2	211.265	4 / 2	2.3	Yes
39180	CHEMBL561720	C12H17N3O2	235.287	4 / 2	2.0	Yes
42374	5-isopropyl-1H-pyrazole-3-carboxylic acid	C7H10N2O2	154.169	3 / 2	1.2	Yes
45086	4-(allylamino)-3-nitrobenzoic acid	C10H10N2O4	222.2	5 / 2	2.5	Yes
46066	4-(cyclopentylamino)-3-nitrobenzoic acid	C12H14N2O4	250.254	5 / 2	3.1	Yes
46197	CHEMBL202657	C14H9F2N3O2	289.242	6 / 1	2.4	Yes
553463	D-phenylalanine	C9H11NO2	165.192	3 / 2	-1.5	Yes
48984	CHEMBL562675	C14H13N3O2S2	319.397	6 / 2	3.0	Yes
53192	CHEMBL2036951	C11H10F2N2O4	272.208	6 / 2	0.6	Yes
56810	CHEMBL374111	C12H9ClO4	252.65	4 / 1	2.3	Yes
58466	ACIFRAN	C12H10O4	218.208	4 / 1	1.7	Yes
58660	CHEMBL1671877	C14H14F2N2O3	296.274	6 / 1	2.3	Yes
60161	CHEMBL561920	C18H17N3O2	307.353	4 / 2	3.5	Yes
61737	ACIPIMOX	C6H6N2O3	154.125	4 / 1	-1.0	Yes
66128	4-(sec-butylamino)-3-nitrobenzoic acid	C11H14N2O4	238.243	5 / 2	3.1	Yes
71891	1-Benzyl-1,2,3-benzotriazole-5-carboxylic acid	C14H11N3O2	253.261	4 / 1	2.2	Yes
76183	CHEMBL397055	C6H7FN6	182.162	5 / 2	0.4	Yes
84672	CHEMBL393064	C7H10N6	178.199	4 / 2	0.7	Yes
91851	CHEMBL550153	C14H13N3O3S	303.336	6 / 2	2.3	Yes
97409	CHEMBL220001	C13H9F3O4	286.206	7 / 1	2.6	Yes
99321	1-Cyclohexyl-1H-benzotriazole-5-carboxylic acid	C13H15N3O2	245.282	4 / 1	2.6	Yes
101871	CHEMBL383367	C20H15N3O2	329.359	4 / 1	3.9	Yes
102125	CHEMBL562933	C14H25N3O2	267.373	4 / 2	3.9	Yes
103782	CHEMBL223140	C10H8O4S	224.23	5 / 1	1.4	Yes
112443	CHEMBL201048	C12H15N3O2	233.271	4 / 1	2.7	Yes
116666	CHEMBL2036813	C11H12N2O4	236.227	4 / 2	0.7	Yes
123535	CHEMBL439028	C14H10N2O5	286.243	5 / 2	2.3	Yes
124489	CHEMBL219950	C14H14O4	246.262	4 / 1	2.5	Yes
125920	CHEMBL373880	C10H8O5	208.169	5 / 1	0.8	Yes
127690	6-(dipropylamino)nicotinic acid	C12H18N2O2	222.288	4 / 1	2.6	Yes
132887	CHEMBL3299016	C19H17ClN2O3	356.806	4 / 2	4.3	Yes
132941	CHEMBL223623	C11H10O4S	238.257	5 / 1	1.8	Yes
135653	4-(cyclopropylamino)-3-nitrobenzoic acid	C10H10N2O4	222.2	5 / 2	2.4	Yes
138447	CHEMBL3299014	C22H24N2O6	412.442	7 / 2	3.3	Yes
145833	CHEMBL1224070	C16H14ClN3O3	331.756	5 / 1	3.0	Yes
146285	CHEMBL552399	C9H15N3O2	197.238	4 / 3	2.1	Yes
147298	1-Propyl-1,2,3-benzotriazole-5-carboxylic acid	C10H11N3O2	205.217	4 / 1	1.7	Yes
147499	CHEMBL3299011	C19H18N2O3	322.364	4 / 2	3.3	Yes
148425	CHEMBL2036954	C13H14N2O4	262.265	4 / 2	1.2	Yes
554033	2-Hydroxyoctanoic acid	C8H16O3	160.213	3 / 2	2.0	Yes
157029	CHEMBL221282	C10H7ClO4S	258.672	5 / 1	2.3	Yes
159162	CHEMBL553415	C8H13N3O2	183.211	4 / 3	1.7	Yes
159537	CHEMBL564914	C16H15N3O2S	313.375	5 / 2	3.2	Yes
161776	6-(diethylamino)pyridine-3-carboxylic acid	C10H14N2O2	194.234	4 / 1	1.6	Yes
168709	CHEMBL202427	C15H13N3O3	283.287	5 / 1	2.2	Yes
169466	CHEMBL3297873	C19H20N2O3	324.38	4 / 2	3.1	Yes
170783	CHEMBL373752	C13H12O5	248.234	5 / 1	1.6	Yes
176220	CHEMBL553912	C16H29N3O2	295.427	4 / 2	5.2	No
177143	4-(methylamino)-3-nitrobenzoic acid	C8H8N2O4	196.162	5 / 2	1.9	Yes
184399	CHEMBL3299116	C18H21NO5	331.368	5 / 2	3.0	Yes
184899	CHEMBL375754	C11H12O4	208.213	4 / 1	1.2	Yes
192438	CHEMBL394468	C9H10N2O2	178.191	4 / 2	1.3	Yes
200430	6-(cyclobutylamino)nicotinic acid	C10H12N2O2	192.218	4 / 2	1.6	Yes
202090	CHEMBL3298703	C21H21NO3	335.403	3 / 2	4.1	Yes
204777	CHEMBL557298	C20H21N3O2	335.407	4 / 2	4.4	Yes
207908	3-nitro-4-(pyrrolidin-1-yl)benzoic acid	C11H12N2O4	236.227	5 / 1	1.9	Yes
210337	CHEMBL3297875	C20H21ClN2O4	388.848	5 / 2	4.1	Yes
218205	CHEMBL396382	C11H16N2O2	208.261	4 / 2	2.5	Yes
554370	(3S)-3-hydroxyoctanoic acid	C8H16O3	160.213	3 / 2	1.4	Yes
221822	CHEMBL376419	C12H8F2O4	254.189	6 / 1	1.9	Yes
221990	CHEMBL2036955	C13H14N2O4	262.265	4 / 2	1.2	Yes
224052	CHEMBL3299114	C17H17NO5	315.325	5 / 2	2.9	Yes
224165	CHEMBL375625	C12H8F2O4	254.189	6 / 1	1.9	Yes
225515	CHEMBL237077	C12H16N2O4	252.27	5 / 2	3.6	Yes
226591	CHEMBL222955	C12H8Cl2O4	287.092	4 / 1	2.9	Yes
228014	CHEMBL424938	C11H10O4S	238.257	5 / 1	1.8	Yes
229378	CHEMBL3297797	C18H20ClNO5	365.81	5 / 2	3.6	Yes
232132	6-(cyclopentylamino)nicotinic acid	C11H14N2O2	206.245	4 / 2	2.0	Yes
232541	4-(isopropylamino)-3-nitrobenzoic acid	C10H12N2O4	224.216	5 / 2	2.7	Yes
242416	CHEMBL424750	C10H7ClO4S	258.672	5 / 1	2.4	Yes
244923	13426-16-9	C12H10N2O2	214.224	4 / 2	2.3	Yes
248575	6-(isopropylamino)nicotinic acid	C9H12N2O2	180.207	4 / 2	1.5	Yes
249611	CHEMBL3299113	C18H17NO3	295.338	3 / 2	3.4	Yes
251082	3-nitro-4-(propylamino)benzoic acid	C10H12N2O4	224.216	5 / 2	2.7	Yes
251851	CHEMBL3299015	C20H20N2O4	352.39	5 / 2	3.6	Yes
255144	4-(butylamino)-3-nitrobenzoic acid	C11H14N2O4	238.243	5 / 2	3.1	Yes
258686	1-Cyclopentyl-1,2,3-benzotriazole-5-carboxylic acid	C12H13N3O2	231.255	4 / 1	2.1	Yes
260406	691363-24-3	C11H13N3O2	219.244	4 / 1	1.5	Yes
262962	CHEMBL396879	C11H16N2O2	208.261	4 / 2	2.5	Yes
264566	4-(1-ETHYL-PROPYLAMINO)-3-NITRO-BENZOIC ACID	C12H16N2O4	252.27	5 / 2	3.7	Yes
264570	CHEMBL564907	C18H15F2N3O2	343.334	6 / 2	3.7	Yes
269965	nicotinic acid	C6H5NO2	123.111	3 / 1	0.4	Yes
270004	6-benzamidonicotinic acid	C13H10N2O3	242.234	4 / 2	1.5	Yes
271587	CHEMBL223566	C11H10O4S	238.257	5 / 1	1.8	Yes
278895	6-(pentylamino)nicotinic acid	C11H16N2O2	208.261	4 / 2	2.5	Yes

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417