Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	5-hydroxytryptamine receptor 5B
Species	Mus musculus (Mouse)
Gene	Htr5b
Synonym	MR22 HTR5B GPR134 G protein-coupled receptor 134 5-HT-5B 5Ht5b 5-hydroxytryptamine (serotonin) receptor 5B, pseudogene 5-ht5b receptor 5-HT5B serotonin receptor 5B [ Show all ]
Disease	N/A for non-human GPCRs
Length	370
Amino acid sequence	MEVSNLSGATPGLAFPPGPESCSDSPSSGRSMGSTPGGLILPGREPPFSAFTVLVVTLLVLLIAATFLWNLLVLVTILRVRAFHRVPHNLVASTAVSDVLVAVLVMPLSLVSELSAGRRWQLGRSLCHVWISFDVLCCTASIWNVAAIALDRYWTITRHLQYTLRTRSRASALMIAITWALSALIALAPLLFGWGEAYDARLQRCQVSQEPSYAVFSTCGAFYLPLAVVLFVYWKIYKAAKFRFGRRRRAVVPLPATTQAKEAPPESEMVFTARRRATVTFQTSGDSWREQKEKRAAMMVGILIGVFVLCWIPFFLTELISPLCACSLPPIWKSIFLWLGYSNSFFNPLIYTAFNKNYNNAFKSLFTKQR
UniProt	P31387
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	N/A
IUPHAR	648
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
11743	propranolol	C16H21NO2	259.349	3 / 2	3.0	Yes
13656	8-OH-Dpat	C16H25NO	247.382	2 / 1	4.1	Yes
26624	Yohimbine	C21H26N2O3	354.45	4 / 2	2.9	Yes
83866	Ketanserin	C22H22FN3O3	395.434	5 / 1	2.6	Yes
171175	15532-75-9	C11H13F3N2	230.234	5 / 1	2.3	Yes
174887	methysergide	C21H27N3O2	353.466	3 / 2	2.3	Yes
175644	sumatriptan	C14H21N3O2S	295.401	4 / 2	0.9	Yes
176692	RU 24969	C14H16N2O	228.295	2 / 2	1.8	Yes
554458	[125I]lysergide	C20H24IN3O	447.337	2 / 1	3.6	Yes
290320	serotonin	C10H12N2O	176.219	2 / 3	0.2	Yes
299039	methiothepin	C20H24N2S2	356.546	4 / 0	4.2	Yes
313001	dl-Arterenol	C8H11NO3	169.18	4 / 4	-1.2	Yes
364110	Bufotenine	C12H16N2O	204.273	2 / 2	1.2	Yes
367175	dopamine	C8H11NO2	153.181	3 / 3	-1.0	Yes
375970	5-Carboxamidotryptamine	C11H13N3O	203.245	2 / 3	-0.6	Yes
388253	ERGOTAMINE	C33H35N5O5	581.673	6 / 3	2.0	No

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417