Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Putative P2Y purinoceptor 10
Species	Homo sapiens (Human)
Gene	P2RY10
Synonym	P2Y-like receptor P2RY10 purinergic receptor P2Y purinergic receptor P2Y, G-protein coupled 10 purinergic receptor P2Y10 P2Y10 [ Show all ]
Disease	N/A
Length	339
Amino acid sequence	MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
UniProt	O00398
Protein Data Bank	N/A
GPCR-HGmod model	O00398
3D structure model	This predicted structure model is from GPCR-EXP O00398.
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL3562166
IUPHAR	165
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
557914	CHEMBL81113	C21H26N2O5S	418.508	6 / 2	2.8	Yes
467468	CHEMBL567724	C24H48NO8P	509.621	9 / 3	4.0	No
468170	CHEMBL3577163	C23H44NO9P	509.577	10 / 4	1.5	No
469559	CHEMBL3577155	C24H48NO8P	509.621	9 / 4	2.5	No
469612	CHEMBL3577149	C22H42NO8P	479.551	9 / 3	2.0	Yes
553610	Sphingosine 1-phosphate	C18H38NO5P	379.478	6 / 4	1.9	Yes
471763	CHEMBL3577142	C24H45FNO8P	525.595	10 / 3	3.2	No
471766	CHEMBL3577141	C24H45FNO8P	525.595	10 / 3	3.2	No
472223	CHEMBL3577180	C26H44NO9P	545.61	10 / 3	2.5	No
473005	CHEMBL3577177	C22H36NO9P	489.502	10 / 3	0.4	Yes
473837	CHEMBL3577154	C24H46NO8P	507.605	9 / 3	3.1	No
474594	CHEMBL3577263	C27H46NO10P	575.636	11 / 4	2.0	No
475156	CHEMBL3577156	C24H47N2O8P	522.62	9 / 5	1.6	No
476068	CHEMBL3577168	C22H36NO10P	505.501	11 / 4	-0.6	No
476221	CHEMBL3577172	C26H44NO10P	561.609	11 / 4	1.6	No
476770	CHEMBL3577164	C23H46NO9P	511.593	10 / 4	2.4	No
478842	CHEMBL3577176	C30H52NO10P	617.717	11 / 4	3.7	No
478850	CHEMBL3577157	C24H48NO7P	493.622	8 / 3	3.5	Yes
479994	CHEMBL3577165	C21H42NO9P	483.539	10 / 4	1.3	Yes
480369	CHEMBL3577264	C23H38NO10P	519.528	11 / 4	-0.2	No
482812	CHEMBL3577262	C26H42F2NO9P	581.591	12 / 3	2.9	No
483139	CHEMBL3577160	C24H46NO9P	523.604	10 / 4	2.1	No
483142	CHEMBL3577138	C24H46NO9P	523.604	10 / 4	2.1	No
483145	CHEBI:52649	C24H46NO9P	523.604	10 / 4	2.1	No
485205	CHEMBL3577159	C24H48NO8P	509.621	9 / 4	1.9	No
486132	CHEMBL3577143	C24H44F2NO8P	543.586	11 / 3	3.4	No
487038	CHEMBL3577181	C26H44NO9P	545.61	10 / 3	2.5	No
488333	CHEMBL3577139	C25H48NO9P	537.631	10 / 3	2.7	No
488958	CHEMBL3577153	C24H46NO8P	507.605	9 / 3	3.1	No
488959	CHEMBL3577137	C24H46NO8P	507.605	9 / 3	3.1	No
490918	CHEMBL3577140	C26H50NO8P	535.659	9 / 3	3.9	No
492361	CHEMBL3577147	C18H36NO9P	441.458	10 / 4	-0.2	Yes
494196	CHEMBL3577178	C24H40NO9P	517.556	10 / 3	1.5	No
494805	CHEMBL3577167	C22H36NO10P	505.501	11 / 4	-0.6	No
495875	CHEMBL3577151	C20H40NO8P	453.513	9 / 3	1.9	Yes
497226	CHEMBL3577174	C30H52NO10P	617.717	11 / 4	3.7	No
497284	CHEMBL3577169	C22H36NO10P	505.501	11 / 4	-0.6	No
498515	CHEMBL3577158	C25H48NO9P	537.631	10 / 3	2.5	No
499691	CHEMBL3577182	C26H43FNO9P	563.6	11 / 3	2.6	No
500833	CHEMBL3577173	C26H44NO10P	561.609	11 / 4	1.6	No
566920	CHEMBL422227	C22H16FN3O	357.388	4 / 0	3.7	Yes
501190	CHEMBL3577170	C24H40NO10P	533.555	11 / 4	0.5	No
567012	D0M2RI	C36H58N6O14S	830.948	15 / 11	1.4	No
501875	CHEMBL3577150	C22H44NO8P	481.567	9 / 3	3.0	Yes
503383	CHEMBL3577162	C25H48NO9P	537.631	10 / 4	2.6	No
503384	CHEMBL3577161	C25H48NO9P	537.631	10 / 4	2.6	No
504463	CHEMBL3577171	C26H44NO10P	561.609	11 / 4	1.6	No
509778	CHEMBL3577175	C30H52NO10P	617.717	11 / 4	3.7	No
555184	lysophosphatidic acid	C21H41O7P	436.526	7 / 3	5.2	No
509935	CHEMBL3577152	C18H36NO8P	425.459	9 / 3	0.8	Yes
511416	CHEMBL3577145	C22H44NO9P	497.566	10 / 4	2.0	Yes
511639	CHEMBL3577148	C16H32NO9P	413.404	10 / 4	-1.3	Yes
512214	CHEMBL3577144	C22H42NO9P	495.55	10 / 4	1.1	Yes
513052	CHEMBL3577179	C26H44NO9P	545.61	10 / 3	2.5	No
515909	CHEMBL3577146	C20H40NO9P	469.512	10 / 4	0.9	Yes
515974	CHEMBL3577265	C27H47N2O9P	574.652	10 / 5	1.4	No

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417