Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	D(2) dopamine receptor
Species	Homo sapiens (Human)
Gene	DRD2
Synonym	dopamine receptor 2 Dopamine D2 receptor D2R D2A and D_2B D2(415) and D₂₍₄₄₄₎ D2 receptor [ Show all ]
Disease	Substance dependence Major depressive disorder Maintain blood pressure in hypotensive states Insomnia Inflammatory disease Inflammatory bowel disease Idiopathic thrombocytopenic purpura Hypertension; Angina pectoris Hypertension Hyperprolactinemia Huntington's disease Glaucoma Gastrointestinal problems Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension Migraine headaches Nasal congestion Sexual dysfunction Schizophrenia; Schizoaffective disorders Schizophrenia; Bipolar disorder Schizophrenia Psychotic disorders Psychosis Postpartum haemorrhage Peripheral vasoconstriction; Pulmonary hypertension Parkinson's disease Pain; Inflammatory diseases Ophthalmic disease Non-small cell lung cancer Nausea; Vomiting Fibrosis False perceptions; Bipolar disorder Emesis Chronic obstructive pulmonary disease Cerebrovascular ischaemia Cardiotonic Cardiac failure Bacterial infections Breast cancer Bipolar disorder; Schizophrenia Bipolar disorder Corneal vascularity; Hyperaemia; Itching Asthma; Bronchitis Anxiety disorder Carcinoid syndrome; Acromegaly Advanced stage Parkinson's disease Dermal necrosis Depressive fatigue Alcohol use disorders Allergy Alzheimer disease Hypotension [ Show all ]
Length	443
Amino acid sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
UniProt	P14416
Protein Data Bank	6cm4, 6c38
GPCR-HGmod model	P14416
3D structure model	This structure is from PDB ID 6cm4.
BioLiP	BL0408379, BL0403379
Therapeutic Target Database	T67162
ChEMBL	CHEMBL217
IUPHAR	215
DrugBank	BE0000756

Ligand

Name	7-OH-DPAT
Molecular formula	C16H25NO
IUPAC name	7-(dipropylamino)-5,6,7,8-tetrahydronaphthalen-2-ol
Molecular weight	247.382
Hydrogen bond acceptor	2
Hydrogen bond donor	1
XlogP	4.1
Synonyms	AC1Q7AGR CHEBI:111176 GTPL3296 NCGC00015494-05 [3H]7-OH-DPAT (+)7-OH-DPAT 7-Hydroxy-DPAT hydrobromide 7-OH-DPAT,(+) Biomol-NT_000011 CTK5E0721 L000014 NCGC00024742-03 (R,S) 7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol 7-(dipropylamino)-5,6,7,8-tetrahydronaphthalen-2-ol BRD-A18795974-004-02-4 D0Z4QZ N,N-Di-n-propyl-7-hydroxy-2-aminotetralin SCHEMBL623950 (+)-7-(Dipropylamino)-5,6,7,8-tetrahydronaphthalen-2-ol hydrobromide 2-Naphthalenol,7-(dipropylamino)-5,6,7,8-tetrahydro- 7-hydroxy-2-(dipropylamino)tetralin AKOS015913437 GTPL950 NCGC00015494-06 (+/-)-7-(dipropylamino)-5,6,7,8-tetrahydronaphthalen-2-ol 7-Hydroxy-N,N-di-n-propyl-2-aminotetralin 7-OH-DPAT,(-) BPBio1_001143 D03PYX Lopac0_000616 PDSP1_001643 7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol AC1L1AZK CCG-204705 DP-7-AT NCGC00015494-04 [3H]-7-OH-DPAT (+)-7-hydroxy-2-aminopropylaminotetralin 3-(dipropylamino)tetralin-6-ol 7-Hydroxy-2-N,N-dipropylaminotetralin BDBM50020222 CHEMBL285755 I14-4633 NCGC00024742-02 (+/-)-7-hydroxy-2-(N,N-di-n-propylamino)tetralin 7-(Dipropylamino)-5,6,7,8-tetrahydro-2-naphthalenol 7-Ohdpat BRD-A18795974-001-01-2 D0XQ8N LS-94989 PDSP2_001627 2-Naphthalenol, 7-(dipropylamino)-5,6,7,8-tetrahydro- 7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol (DP-7-ADTN) [ Show all ]
Inchi Key	BLYMJBIZMIGWFK-UHFFFAOYSA-N
Inchi ID	InChI=1S/C16H25NO/c1-3-9-17(10-4-2)15-7-5-13-6-8-16(18)12-14(13)11-15/h6,8,12,15,18H,3-5,7,9-11H2,1-2H3
PubChem CID	1219
ChEMBL	CHEMBL285755
IUPHAR	3296, 950
BindingDB	50020222
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
EC50	39.8 nM	PMID18410082	BindingDB,ChEMBL
Emax	61.4 %	PMID18410082	ChEMBL
Ki	2.27 nM	PMID27035329	ChEMBL
Ki	2.3 nM	PMID27035329	BindingDB
Ki	2.7 nM	PMID7756621	PDSP
Ki	25.1189 - 2511.89 nM	PMID8301582, PMID7907989, PMID7576010	IUPHAR
Ki	60.0 nM	PMID8301582	PDSP,BindingDB
Ki	89.0 nM	PMID9067310	PDSP,BindingDB
Ki	103.0 nM	PMID7756621	PDSP
Ki	142.0 nM	PMID8230102, PMID7990123	BindingDB,ChEMBL
Ki	143.0 nM	PMID27035329	BindingDB,ChEMBL
Ki	158.48 nM	PMID10611634	PDSP,BindingDB
Ki	202.0 nM	PMID20146482	ChEMBL
Ki	1430.0 nM	PMID23018094	BindingDB
Ki	1780.0 nM	PMID9067310	PDSP,BindingDB

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417