VPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRLI
FAENAIKLMYKRDGLALTLSNDVHGNDGRLAFGDGKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVGTNPNGD
HMAFGVNSVDSFRAQWYLQPAKYDKDNLFYIYNREYSKALTLSRTLETSGNRMAWGYNGRVIGSPEHYAWGVKAF
The query sequence (length=235) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4efp:A | 235 | 235 | 1.0000 | 1.0000 | 1.0000 | 2.11e-178 | 4efp:B, 4efq:A, 4efq:B |
2 | 4nbm:C | 369 | 57 | 0.0723 | 0.0461 | 0.2982 | 3.0 | 4nbm:D, 4nc4:A, 4nc4:C |
3 | 6xwk:AAA | 162 | 43 | 0.0553 | 0.0802 | 0.3023 | 3.9 | |
4 | 3v71:A | 364 | 39 | 0.0468 | 0.0302 | 0.2821 | 4.2 | |
5 | 7ncz:A | 227 | 103 | 0.0979 | 0.1013 | 0.2233 | 7.2 | 7nm6:A, 7npp:A, 7ny3:A, 7o6h:A, 7oof:A, 7ory:A, 7p25:A, 7p90:A, 7pbf:A |
6 | 6aem:A | 84 | 43 | 0.0596 | 0.1667 | 0.3256 | 8.0 | 6aem:B |
7 | 5ntg:A | 512 | 66 | 0.1021 | 0.0469 | 0.3636 | 8.1 | 5ntg:B |
8 | 1f99:A | 162 | 42 | 0.0596 | 0.0864 | 0.3333 | 8.5 | 1f99:K, 1f99:M |
9 | 1i7y:A | 162 | 43 | 0.0511 | 0.0741 | 0.2791 | 9.3 | 1ktp:A, 6ypq:A, 6yyj:A, 6yyj:E, 6yyj:C |
10 | 5gll:A | 331 | 65 | 0.0809 | 0.0574 | 0.2923 | 9.4 | 5glk:B, 5glm:A, 5glm:B, 5gln:A, 5gln:B, 5glo:A, 5glo:B, 5glp:A, 5glp:B, 5glq:A, 5glq:B, 5glr:A, 5glr:B |