SEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQN
RFKVPLGTKFYRVKAVSWN
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8yfk:G | 99 | 99 | 1.0000 | 1.0000 | 1.0000 | 2.05e-71 | 7czm:A, 7d0e:A, 8yfk:A, 8yfk:C, 8yfk:E, 8yfl:A, 8yfl:C, 8yfm:A, 8yfm:D, 8yfn:A, 8yfn:C |
2 | 7czm:B | 94 | 99 | 0.8889 | 0.9362 | 0.8889 | 2.98e-59 | |
3 | 4d9u:A | 307 | 30 | 0.1313 | 0.0423 | 0.4333 | 0.093 | 4d9t:A, 4jg6:A, 4jg7:A, 4jg8:A, 4m8t:A, 4mao:A, 5o1s:A |
4 | 1dcq:A | 276 | 44 | 0.1414 | 0.0507 | 0.3182 | 0.69 | |
5 | 4o2z:A | 363 | 41 | 0.1313 | 0.0358 | 0.3171 | 0.80 | |
6 | 3ml1:B | 109 | 30 | 0.1414 | 0.1284 | 0.4667 | 2.5 | 3o5a:B |
7 | 3gc8:A | 347 | 81 | 0.1717 | 0.0490 | 0.2099 | 3.2 | 3gc8:B, 3gc9:A, 3gc9:B, 3gp0:A, 8ygw:A |
8 | 5wvd:A | 241 | 32 | 0.1212 | 0.0498 | 0.3750 | 4.2 | |
9 | 1avf:J | 322 | 48 | 0.1313 | 0.0404 | 0.2708 | 6.0 | 1avf:A |
10 | 7t80:A | 216 | 28 | 0.1313 | 0.0602 | 0.4643 | 8.8 | 7t80:B |
11 | 7m0r:E | 458 | 25 | 0.1111 | 0.0240 | 0.4400 | 9.3 | 7m0r:F |