BioLiP

>protein
QALLIKVPTEIVVKVVDDVDVAAPAVGQVGKFDDELYDEAGAQIGTSSGNFRIEYVRPTDGGLLTYYQEDITLSDGVIHA
EGWADFNDVRTSKWVFYPATGVSGRYLGLTGFRQWRMTGVRKSAEARILLGE

The query sequence (length=132) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7pxo:AAA	136	132	1.0000	0.9706	1.0000	3.30e-94	7pxo:BBB, 7pxo:DDD
2	8of7:A	139	91	0.2727	0.2590	0.3956	1.45e-16
3	8of7:B	119	107	0.2803	0.3109	0.3458	1.10e-13
4	7x81:A	145	94	0.2424	0.2207	0.3404	2.84e-04	7x81:B, 7x86:A, 7x86:B, 7x86:C, 7x86:D
5	5bu3:A	181	79	0.1894	0.1381	0.3165	0.001	5bu3:B, 5bu3:C, 5bu3:D, 7dvk:A, 7dvk:B, 7dvk:C, 7dvk:D
6	8do6:H	327	88	0.1667	0.0673	0.2500	0.46	7uzz:E, 7v00:E, 7v01:E, 7v02:E
7	6nnw:A	208	125	0.2045	0.1298	0.2160	1.3	6nnw:B
8	5l43:A	662	77	0.1818	0.0363	0.3117	1.4	5l43:B, 5l44:A, 5l44:B
9	6sga:F7	662	32	0.0985	0.0196	0.4062	1.4	7pua:F7, 7pub:F7, 6sgb:F7
10	1t3q:B	786	50	0.1364	0.0229	0.3600	1.9	1t3q:E
11	6wj6:D	342	43	0.1212	0.0468	0.3721	2.2	7n8o:D, 7n8o:d, 7rcv:D, 7rcv:d, 8tow:D, 8tow:d, 8wql:DD, 8wql:DE, 8wql:D1, 8wql:d1, 8wql:dD, 8wql:dE
12	8am5:D	278	41	0.1136	0.0540	0.3659	2.8	8asl:D
13	4gmj:B	264	61	0.1212	0.0606	0.2623	5.6	7ax1:B, 4gmj:D, 4gmj:F
14	4j1q:A	417	60	0.1288	0.0408	0.2833	6.1
15	5ixo:A	596	28	0.0833	0.0185	0.3929	7.6	5ixq:A, 5ixt:A, 5iyv:A, 5iyx:A
16	1f6m:A	320	26	0.0985	0.0406	0.5000	8.7	1cl0:A, 1f6m:B, 1f6m:E, 1f6m:F, 1tde:A, 1tdf:A, 1trb:A

[Back]