GSMICYNQQSSQPPTTKTCSETSCYKKTWRDHRGTIIERGCGCPKVKPGIKLHCCRTDKCNN
The query sequence (length=62) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 9avv:G | 62 | 62 | 1.0000 | 1.0000 | 1.0000 | 1.81e-41 | 9avv:F, 9awk:F, 9awk:G |
| 2 | 5ebx:A | 62 | 61 | 0.7258 | 0.7258 | 0.7377 | 1.09e-26 | 6ebx:B |
| 3 | 1v6p:A | 62 | 62 | 0.6774 | 0.6774 | 0.6774 | 3.82e-24 | 1v6p:B |
| 4 | 8we8:B | 60 | 58 | 0.4516 | 0.4667 | 0.4828 | 6.40e-13 | |
| 5 | 8vy8:B | 75 | 67 | 0.4355 | 0.3600 | 0.4030 | 9.38e-07 | 1abt:A, 2btx:A, 1bxp:A, 1haa:A, 1haj:A, 5hbv:A, 1hc9:A, 1hc9:B, 1hoy:A, 1idg:A, 1idh:A, 1jbd:A, 1kc4:A, 1kl8:A, 1l4w:A, 1ljz:A, 2qc1:A, 1rgj:A, 6uwz:G, 8vy8:A, 8vy8:E, 8vy8:G |
| 6 | 1lxg:A | 71 | 44 | 0.3387 | 0.2958 | 0.4773 | 7.94e-06 | 1lxh:A, 7pc0:K, 6zfm:A, 6zfm:B, 6zfm:D, 6zfm:E |
| 7 | 2bhi:A | 60 | 53 | 0.3226 | 0.3333 | 0.3774 | 0.029 | 2bhi:B, 1h0j:A, 1h0j:B, 1h0j:C, 1xt3:A |
| 8 | 5mg9:A | 65 | 25 | 0.2097 | 0.2000 | 0.5200 | 1.3 | |
| 9 | 7c28:A | 65 | 65 | 0.3226 | 0.3077 | 0.3077 | 1.4 | 7c28:B |
| 10 | 5ta1:A | 627 | 27 | 0.1452 | 0.0144 | 0.3333 | 5.4 | 5ta0:A, 5ta0:B, 5ta5:A, 5ta5:B |
| 11 | 6a5m:A | 488 | 40 | 0.1613 | 0.0205 | 0.2500 | 6.2 | 6a5k:A |
| 12 | 8y85:A | 514 | 30 | 0.2097 | 0.0253 | 0.4333 | 6.8 | 8y85:B, 8y86:A |
| 13 | 6a5n:A | 502 | 40 | 0.1613 | 0.0199 | 0.2500 | 7.1 | |
| 14 | 6bka:A | 374 | 28 | 0.1613 | 0.0267 | 0.3571 | 7.6 | |
| 15 | 5ex0:A | 429 | 37 | 0.2419 | 0.0350 | 0.4054 | 8.1 | 7bj1:A, 5ccl:A, 5ccm:A, 5ex3:A, 5hi7:A, 5hq8:A, 5hq8:B, 6ijl:A, 3mek:A, 7o2a:A, 7o2b:A, 7o2c:A, 6o9o:A, 8owo:A, 3oxf:A, 3oxf:B, 3oxg:A, 3oxl:A, 6p6g:A, 6p6k:A, 6p7z:A, 6paf:A, 3pdn:A, 7qlb:A, 7qnr:A, 7qnu:A, 3qwp:A, 3ru0:A, 3ru0:B, 5v37:A, 5xxd:A, 5xxg:A, 5xxj:A, 5yjo:A, 6yuh:A, 6zrb:A |
| 16 | 8hr5:A | 466 | 28 | 0.1452 | 0.0193 | 0.3214 | 8.1 | |
| 17 | 5lj3:C | 882 | 25 | 0.1290 | 0.0091 | 0.3200 | 8.5 | 6exn:C, 5gam:C, 5gan:C, 5lj5:C, 5lqw:B, 5mps:C, 5mq0:C, 5nrl:C |
| 18 | 6j6g:C | 920 | 25 | 0.1290 | 0.0087 | 0.3200 | 8.5 | 7b9v:C, 6bk8:B, 7dco:C, 5gm6:C, 5gmk:C, 6j6h:C, 6j6n:C, 6j6q:C, 3jcm:H, 6teo:A, 6teo:C, 5wsg:C, 5y88:C, 5ylz:C, 5zwm:C, 5zwo:C |
umich.edu