AAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARGEDYEKVK
LLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEI
DRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV
The query sequence (length=224) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 9fmd:M | 224 | 224 | 1.0000 | 1.0000 | 1.0000 | 1.48e-164 | 8c6j:y, 8i0u:M, 8i0v:M, 8i0w:M, 6icz:M, 6id0:M, 6id1:M, 5mqf:N, 6qdv:y, 8ro2:M, 7w59:M, 7w5a:M, 7w5b:M, 5xjc:M, 5yzg:M |
2 | 8ro0:M | 196 | 209 | 0.4241 | 0.4847 | 0.4545 | 8.93e-53 | 8ro1:M |
3 | 6mvf:A | 643 | 53 | 0.0759 | 0.0264 | 0.3208 | 1.9 | 6mvf:B, 6mvf:C, 6mvf:D, 6mvf:E, 6mvf:F |
4 | 2zyl:A | 359 | 45 | 0.0759 | 0.0474 | 0.3778 | 5.1 | 4qck:A |
5 | 7aov:A | 377 | 78 | 0.1116 | 0.0663 | 0.3205 | 5.1 | 7aov:B |
6 | 8a22:Ac | 303 | 53 | 0.0759 | 0.0561 | 0.3208 | 7.3 | 8apn:Ac, 8apo:Ac |
7 | 8sl7:D | 544 | 42 | 0.0625 | 0.0257 | 0.3333 | 8.7 | 8sl7:A, 8sl7:B, 8sl7:C |
8 | 1l4a:B | 82 | 48 | 0.0670 | 0.1829 | 0.3125 | 9.7 |