Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Adenosine receptor A2b
Species	Homo sapiens (Human)
Gene	ADORA2B
Synonym	adenosine receptor A2b A2BR A2B receptor A2b
Disease	Paroxysmal supraventricular tachycardia Non-insulin dependent diabetes Hypertension Herpes simplex virus infection Apnea Asthma [ Show all ]
Length	332
Amino acid sequence	MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL
UniProt	P29275
Protein Data Bank	N/A
GPCR-HGmod model	P29275
3D structure model	This predicted structure model is from GPCR-EXP P29275.
BioLiP	N/A
Therapeutic Target Database	T86679
ChEMBL	CHEMBL255
IUPHAR	20
DrugBank	BE0000241

Ligand

Name	8-Cyclopentyl-1,3-dipropylxanthine
Molecular formula	C16H24N4O2
IUPAC name	8-cyclopentyl-1,3-dipropyl-7H-purine-2,6-dione
Molecular weight	304.394
Hydrogen bond acceptor	3
Hydrogen bond donor	1
XlogP	4.0
Synonyms	L000233 NCGC00015177-01 NCGC00015177-09 8-Cyclopentyl-3,7-dihydro-1,3-dipropyl-1H-purin-2,6-dione NCGC00261066-01 ANW-45129 PDSP1_000448 C-18978 SMR000058434 CTK8B4471 SR-01000003000 DPCPX; PD 116,948 VZ31021 HMS2235C14 KBio1_000177 LP00381 1,3-DIPROPYL-8-CYCLOPENTYLXANTHINE [DPCPX] NCGC00015177-04 8-cyclopentyl-1,3-dipropyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione NCGC00023294-02 AC1L1B8K OR9885T BCBcMAP01_000212 PDSP2_001192 CCG-221685 Spectrum2_001808 DB12946 SR-01000075202-1 EX-3308 ZINC3977757 HMS3369D05 KBio2_005887 KBioSS_000751 MLS001076525 1H-Purine-2,6-dione, 8-cyclopentyl-3,7-dihydro-1,3-dipropyl- NCGC00015177-07 NCGC00023294-06 AKOS015900114 PD-116948 BRD-K01824921-001-10-2 SCHEMBL12648692 Spectrum5_001887 DPCPX Tox21_500381 GNF-PF-2224 IDI1_000177 Lopac-C-101 NCGC00015177-02 8-cyclopentyl-1,3-dipropyl-1H-purine-2,6(3H,7H)-dione NCGC00015177-10 8-Cyclopentyl-3,7-dihydro-1,3-dipropyl-1H-purine-2,6-dione NINDS_000177 AX8008808 PDSP1_001208 C13709 SPBio_001795 D0K0OT SR-01000003000-2 DTXSID50144706 W-200660 HMS3261M03 KBio2_000751 KBio3_001906 LS-126534 1,3-Dpcpx NCGC00015177-05 8-cyclopentyl-1,3-dipropyl-3,7-dihydro-1H-purine-2,6-dione NCGC00023294-04 AJ-47554 PD 116948 BDBM21173 SC-91856 CCG-39732 Spectrum3_001073 dipropylcyclopentylxanthine ST2406601 FFBDFADSZUINTG-UHFFFAOYSA-N ZX-AT022179 HMS500I19 KS-0000186U MolPort-003-666-763 NCGC00015177-08 8-Cyclopentyl-1,3-dipropylxanthine, solid NCGC00023294-07 AKOS024458134 PD116948 BSPBio_002686 SCHEMBL382422 CHEMBL183 Spectrum_000271 DPCPX, 1,3-Dipropyl-8-cyclopentylxanthine UNII-9PTP4FOI9E GTPL386 KB-53263 Lopac0_000381 1,3-dipropyl-8-cyclopentylxanthine NCGC00015177-03 8-Cyclopentyl-1,3-dipropyl-1H-purine-2,6(3H,7H);-dione NCGC00015177-11 9PTP4FOI9E Opera_ID_160 B6305 PDSP2_000446 CC-23366 SPECTRUM2300063 D0OW4Q SR-01000075202 EU-0100381 X8593 HMS3266O21 KBio2_003319 KBioGR_001696 MLS000069347 102146-07-6 NCGC00015177-06 8-cyclopentyl-1,3-dipropyl-7H-purine-2,6-dione NCGC00023294-05 AK-88727 PD-116,948 BRD-K01824921-001-02-9 SCHEMBL1094807 CHEBI:73282 Spectrum4_001228 DivK1c_000177 Tocris-0439 FT-0621530 [DPCPX] I14-10012 [ Show all ]
Inchi Key	FFBDFADSZUINTG-UHFFFAOYSA-N
Inchi ID	InChI=1S/C16H24N4O2/c1-3-9-19-14-12(15(21)20(10-4-2)16(19)22)17-13(18-14)11-7-5-6-8-11/h11H,3-10H2,1-2H3,(H,17,18)
PubChem CID	1329
ChEMBL	CHEMBL183
IUPHAR	386
BindingDB	21173
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	40.0 nM	PMID11809867	PDSP,BindingDB
Ki	50.1187 - 125.893 nM	PMID16020631, PMID15194002, PMID16902942, PMID12014951	IUPHAR
Ki	51.0 nM	PMID15771453, PMID20937560, PMID11906291	PDSP,BindingDB,ChEMBL
Ki	56.0 nM	PMID16759111, PMID20537438	BindingDB,ChEMBL
Ki	63.8 nM	PMID12014951	BindingDB,ChEMBL
Ki	73.0 nM	PMID26824742	BindingDB
Ki	73.24 nM	PMID26824742	ChEMBL
Ki	1000.0 nM	PMID19282184	BindingDB,ChEMBL

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417