Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Adenosine receptor A1
Species	Homo sapiens (Human)
Gene	ADORA1
Synonym	RDC7 A1 receptor A1-AR A1R adenosine receptor A1
Disease	Cardiac arrhythmias Hypertension Cardiac disease Cognitive disorders Diabetes Fatigue; Orthostatic hypotension Glaucoma Heart failure Autoimmune diabetes Atrial fibrillation; Cardiac arrhythmias Atrial fibrillation Sepsis Renal failure Parkinson's disease Neuropathic pain Acute and chronic heart failure Multiple scierosis Hypertriglyceridemia Allergy Asthma Hyperlipidaemia [ Show all ]
Length	326
Amino acid sequence	MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD
UniProt	P30542
Protein Data Bank	6d9h, 5n2s
GPCR-HGmod model	P30542
3D structure model	This structure is from PDB ID 6d9h.
BioLiP	BL0385576, BL0417675
Therapeutic Target Database	T88714, T92072
ChEMBL	CHEMBL226
IUPHAR	18
DrugBank	BE0000013

Ligand

Name	8-Cyclopentyl-1,3-dipropylxanthine
Molecular formula	C16H24N4O2
IUPAC name	8-cyclopentyl-1,3-dipropyl-7H-purine-2,6-dione
Molecular weight	304.394
Hydrogen bond acceptor	3
Hydrogen bond donor	1
XlogP	4.0
Synonyms	PD 116948 BDBM21173 SC-91856 CCG-39732 Spectrum3_001073 dipropylcyclopentylxanthine ST2406601 FFBDFADSZUINTG-UHFFFAOYSA-N ZX-AT022179 HMS500I19 KBio3_001906 LS-126534 1,3-Dpcpx NCGC00015177-05 8-cyclopentyl-1,3-dipropyl-3,7-dihydro-1H-purine-2,6-dione NCGC00023294-04 AJ-47554 AKOS024458134 PD116948 BSPBio_002686 SCHEMBL382422 CHEMBL183 Spectrum_000271 DPCPX, 1,3-Dipropyl-8-cyclopentylxanthine UNII-9PTP4FOI9E GTPL386 KB-53263 KS-0000186U MolPort-003-666-763 NCGC00015177-08 8-Cyclopentyl-1,3-dipropylxanthine, solid NCGC00023294-07 Opera_ID_160 B6305 PDSP2_000446 CC-23366 SPECTRUM2300063 D0OW4Q SR-01000075202 EU-0100381 X8593 HMS3266O21 KBio2_003319 Lopac0_000381 1,3-dipropyl-8-cyclopentylxanthine NCGC00015177-03 8-Cyclopentyl-1,3-dipropyl-1H-purine-2,6(3H,7H);-dione NCGC00015177-11 9PTP4FOI9E PD-116,948 BRD-K01824921-001-02-9 SCHEMBL1094807 CHEBI:73282 Spectrum4_001228 DivK1c_000177 Tocris-0439 FT-0621530 [DPCPX] I14-10012 KBioGR_001696 MLS000069347 102146-07-6 NCGC00015177-06 8-cyclopentyl-1,3-dipropyl-7H-purine-2,6-dione NCGC00023294-05 AK-88727 ANW-45129 PDSP1_000448 C-18978 SMR000058434 CTK8B4471 SR-01000003000 DPCPX; PD 116,948 VZ31021 HMS2235C14 KBio1_000177 L000233 NCGC00015177-01 NCGC00015177-09 8-Cyclopentyl-3,7-dihydro-1,3-dipropyl-1H-purin-2,6-dione NCGC00261066-01 OR9885T BCBcMAP01_000212 PDSP2_001192 CCG-221685 Spectrum2_001808 DB12946 SR-01000075202-1 EX-3308 ZINC3977757 HMS3369D05 KBio2_005887 LP00381 1,3-DIPROPYL-8-CYCLOPENTYLXANTHINE [DPCPX] NCGC00015177-04 8-cyclopentyl-1,3-dipropyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione NCGC00023294-02 AC1L1B8K AKOS015900114 PD-116948 BRD-K01824921-001-10-2 SCHEMBL12648692 Spectrum5_001887 DPCPX Tox21_500381 GNF-PF-2224 IDI1_000177 KBioSS_000751 MLS001076525 1H-Purine-2,6-dione, 8-cyclopentyl-3,7-dihydro-1,3-dipropyl- NCGC00015177-07 NCGC00023294-06 AX8008808 PDSP1_001208 C13709 SPBio_001795 D0K0OT SR-01000003000-2 DTXSID50144706 W-200660 HMS3261M03 KBio2_000751 Lopac-C-101 NCGC00015177-02 8-cyclopentyl-1,3-dipropyl-1H-purine-2,6(3H,7H)-dione NCGC00015177-10 8-Cyclopentyl-3,7-dihydro-1,3-dipropyl-1H-purine-2,6-dione NINDS_000177 [ Show all ]
Inchi Key	FFBDFADSZUINTG-UHFFFAOYSA-N
Inchi ID	InChI=1S/C16H24N4O2/c1-3-9-19-14-12(15(21)20(10-4-2)16(19)22)17-13(18-14)11-7-5-6-8-11/h11H,3-10H2,1-2H3,(H,17,18)
PubChem CID	1329
ChEMBL	CHEMBL183
IUPHAR	386
BindingDB	21173
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Activity	45.0 %	PMID19836950	ChEMBL
Activity	93.0 %	MedChemComm, (2012) 3:3:333	ChEMBL
Activity	133.0 %	PMID18258439	ChEMBL
Change in cAMP	100.0 %	PMID15771447	ChEMBL
IC50	0.5 nM	PMID26988801, PMID27876250	ChEMBL
IC50	0.87 nM	PMID23582449	ChEMBL
IC50	0.89 nM	PMID23466604	ChEMBL
IC50	5.0 nM	PMID26988801, PMID27876250	BindingDB
IC50	6.7 nM	PMID18983139	ChEMBL
IC50	13.0 nM	PMID10476879, PMID18588282	BindingDB,ChEMBL
IC50	14.0 nM	PMID10476879	BindingDB,ChEMBL
IC50	25.0 nM	PMID20875743	BindingDB,ChEMBL
Kd	2.704 nM	DOI: http://dx.doi.org/10.6019/CHEMBL3885741	ChEMBL
Kd	3.0 nM	PMID27282729	BindingDB
Kd	3.715 nM	PMID9871584	ChEMBL
Ki	0.47 nM	PMID1694546	BindingDB,ChEMBL
Ki	0.5 nM	PMID17927167, PMID24077183, PMID18269230, PMID22257095, PMID27282729, PMID16366607	BindingDB,ChEMBL
Ki	0.56 nM	PMID23466604	ChEMBL
Ki	0.63 - 39.8 nM	PMID9920910, PMID16020631, PMID15740718, PMID16902942, PMID8032613	IUPHAR
Ki	0.9 nM	PMID16759111, PMID20537438	BindingDB,ChEMBL
Ki	1.6 nM	PMID18307292, PMID18307293, PMID18189346	BindingDB,ChEMBL
Ki	2.0 nM	PMID11809867	PDSP
Ki	2.13 nM	PMID11960496	BindingDB,ChEMBL
Ki	2.2 nM	PMID26824742	BindingDB,ChEMBL
Ki	2.52 nM	PMID9191953	ChEMBL
Ki	2.93 nM	PMID9191953	BindingDB
Ki	3.0 nM	PMID17201410	BindingDB,ChEMBL
Ki	3.2 nM	PMID19301821, PMID20937560, PMID17665891, PMID15214785, PMID25462223, PMID16789747, PMID18468446, PMID16335918	BindingDB,ChEMBL
Ki	3.9 nM	PMID20408530	BindingDB,ChEMBL
Ki	4.0 nM	PMID19282184	BindingDB,ChEMBL
Ki	4.2 nM	PMID18983139	ChEMBL
Ki	6.1 nM	PMID18258439, J Med Chem. 2005 Mar 24;48(6):2045-53., PMID18637670, PMID15771447	PDSP,BindingDB,ChEMBL
Ki	6.5 nM	PMID16250647	BindingDB,ChEMBL
Ki	6.7 nM	PMID15163184	BindingDB,ChEMBL
Ki	7.0 nM	PMID10476879	BindingDB,ChEMBL
Ki	12.0 nM	PMID14736246	BindingDB,ChEMBL
Ki	12.02 nM	MedChemComm, (2012) 3:3:333	ChEMBL
Ki	12.9 nM	PMID19836950	BindingDB,ChEMBL
Ki	95.0 nM	PMID19036477	BindingDB,ChEMBL
koff	0.25 min^-1	DOI: http://dx.doi.org/10.6019/CHEMBL3885741	ChEMBL
kon	0.14 nM^-1 min^-1	DOI: http://dx.doi.org/10.6019/CHEMBL3885741	ChEMBL
kon	345900.0 Ms-1	DOI: http://dx.doi.org/10.6019/CHEMBL3885741	ChEMBL
k_off	0.0009352 s-1	DOI: http://dx.doi.org/10.6019/CHEMBL3885741	ChEMBL
Production	157.0 %	PMID11960496	ChEMBL

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417