Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	5-hydroxytryptamine receptor 1E
Species	Homo sapiens (Human)
Gene	HTR1E
Synonym	5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled 5-HT1E_alpha 5-ht1e receptor 5-HT1E 5-HT-1E S31 Serotonin receptor 1E [ Show all ]
Disease	N/A
Length	365
Amino acid sequence	MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT
UniProt	P28566
Protein Data Bank	N/A
GPCR-HGmod model	P28566
3D structure model	This predicted structure model is from GPCR-EXP P28566.
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL2182
IUPHAR	4
DrugBank	BE0000476

Ligand

Name	Rauwolscine
Molecular formula	C21H26N2O3
IUPAC name	methyl (1S,15S,18S,19S,20S)-18-hydroxy-1,3,11,12,14,15,16,17,18,19,20,21-dodecahydroyohimban-19-carboxylate
Molecular weight	354.45
Hydrogen bond acceptor	4
Hydrogen bond donor	2
XlogP	2.9
Synonyms	MolPort-002-513-616 Spectrum4_000319 Tox21_110811 20alpha-Yohimban-16beta-carboxylic acid, 17alpha-hydroxy-, methyl ester (8CI) ZINC3977785 alpha-Yohimbine CAS-131-03-3 DivK1c_000414 IDI1_000414 KBioSS_001938 Mesoyohimbine NINDS_000414 SDCCGMLS-0066742.P001 SR-01000075289 131-03-3 Yohimban-16-carboxylic acid, 17-hydroxy-, methyl ester, (16-beta,17-alpha,20-alpha)- (9CI) BRD-K77474816-003-04-2 DSSTox_RID_81001 KBio2_001938 methyl 17alpha-hydroxy-20alpha-yohimban-16beta-carboxylate Prestwick2_000577 Spectrum2_000870 SR-01000075289-8 17alpha-hydroxy-20alpha-yohimban-16beta-carboxylic acid methyl ester Yohimban-16-carboxylic acid, 17-hydroxy-, methyl ester, (17alpha,20alpha)- AJ-47559 BSPBio_000394 D02MFI GTPL136 KBio3_002721 NCGC00017260-05 Rauwolscine (6CI,7CI) Spectrum5_001121 UNII-T4LJ7LU45W [3H]rauwolscine BDBM50026636 CCG-205170 DSSTox_CID_25608 Isoyohimbine Lopac0_001093 Methyl (16beta,17alpha,20alpha)-17-hydroxyyohimban-16-carboxylate Prestwick0_000577 SPBio_000919 SR-01000075289-6 yohimban-16-carboxylic acid, 17-hydroxy-, methyl ester, (16beta,17alpha,20alpha)- AB00514662 BRD-K77474816-003-05-9 CHEMBL10347 DTXSID2045608 KBio2_004506 methyl hydroxy[?]carboxylate Prestwick3_000577 Spectrum3_001761 T4LJ7LU45W 20-alpha-Yohimban-16-beta-carboxylic acid, 17-alpha-hydroxy-, methyl ester Yohimban-16-carboxylicacid, 17-hydroxy-, methyl ester, (16b,17a,20a)- AKOS032948426 BSPBio_003221 D0Z7EA GTPL223 KBioGR_000938 meso-Yohimbine NCGC00017260-06 SCHEMBL244514 Spectrum_001458 .alpha.-Yohimbine W1076 4CN-1422 BPBio1_000434 CHEBI:48562 DSSTox_GSID_45608 KBio1_000414 methyl (1S,15S,18S,19S,20S)-18-hydroxy-1,3,11,12,14,15,16,17,18,19,20,21-dodecahydroyohimban-19-carboxylate Prestwick1_000577 SPBio_002613 SR-01000075289-7 17-alpha-Hydroxy-20-alpha-yohimban-16-beta-carboxylic acid methyl ester Yohimban-16-carboxylic acid, 17-hydroxy-, methyl ester, (16beta,17alpha,20alpha)- (9CI) AC1LD7LA BRD-K77474816-003-09-1 Corynanthidine EINECS 205-006-9 KBio2_007074 [ Show all ]
Inchi Key	BLGXFZZNTVWLAY-DIRVCLHFSA-N
Inchi ID	InChI=1S/C21H26N2O3/c1-26-21(25)19-15-10-17-20-14(13-4-2-3-5-16(13)22-20)8-9-23(17)11-12(15)6-7-18(19)24/h2-5,12,15,17-19,22,24H,6-11H2,1H3/t12-,15+,17+,18+,19+/m1/s1
PubChem CID	643606
ChEMBL	CHEMBL10347
IUPHAR	223, 136
BindingDB	50026636
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	3162.28 - 3981.07 nM	PMID8863519, PMID14744596	IUPHAR

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417