Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Somatostatin receptor type 5
Species	Homo sapiens (Human)
Gene	SSTR5
Synonym	SOMATO SS-5-R SS5-R SS5R SST5 receptor
Disease	N/A
Length	364
Amino acid sequence	MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL
UniProt	P35346
Protein Data Bank	N/A
GPCR-HGmod model	P35346
3D structure model	This predicted structure model is from GPCR-EXP P35346.
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL1792
IUPHAR	359
DrugBank	BE0002147

Ligand

Name	SOMATOSTATIN
Molecular formula	C76H104N18O19S2
IUPAC name	(4R,7S,10S,13S,16S,19S,22S,25S,28S,31S,34S,37R)-19,34-bis(4-aminobutyl)-31-(2-amino-2-oxoethyl)-37-[[2-[[(2S)-2-aminopropanoyl]amino]acetyl]amino]-13,25,28-tribenzyl-10,16-bis[(1R)-1-hydroxyethyl]-7-(hydroxymethyl)-22-(1H-indol-3-ylmethyl)-6,9,12,15,18,21,24,27,30,33,36-undecaoxo-1,2-dithia-5,8,11,14,17,20,23,26,29,32,35-undecazacyclooctatriacontane-4-carboxylic acid
Molecular weight	1637.9
Hydrogen bond acceptor	24
Hydrogen bond donor	22
XlogP	-3.1
Synonyms	51110-01-1 (Parent) Ala-Gly-cyclo-[Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Thr-Ser-Cys] Growth hormone-release inhibiting factor: L-alanylglycyl-L-cysteinyl-L-lysyl-L-asparaginyl-L-phenylalanyl-L-phenylalanyl-L-tryptophyl-L-lysyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-cysteine cyclic (3-14) disulfide MolPort-006-823-896 Somatostatin acetate Somatostatine Synthetic growth hormone release-inhibiting hormone 6E20216Q0L C76H104N18O19S2 D0T5RO HS-2027 Somatostatin, cyclic Somatostatinum [INN-Latin] UNII-F6R2N217HS 15-28-Somatostatin-28 AK552885 CCRIS 3629 F6R2N217HS LS-174755 Somatostatin (rat) Somatostatina SRIF 52769-04-7 BDBM81767 CHEMBL1823872 Growth hormone-release inhibiting factor: L-alanylglycyl-L-cysteinyl-L-lysyl-L-asparaginyl-L-phenylalanyl-L-phenylalanyl-L-tryptophyl-L-lysyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-cysteine cyclic (3->14) disulfide NCGC00167137-01 Somatostatin [BAN:INN] Somatostatine [INN-French] Synthetic somatostatin-14 CAS_38916-34-6 L-alanyl-N-[(4R,7S,10S,13S,16S,19S,22S,25S,28S,31S,34S,37R)-19,34-bis(4-aminobutyl)-31-(2-amino-2-oxoethyl)-13,25,28-tribenzyl-4-carboxy-10,16-bis[(1R)-1-hydroxyethyl]-7-(hydroxymethyl)-22-(1H-indol-3-ylmethyl)-6,9,12,15,18,21,24,27,30,33,36-undecaoxo-1,2 Somatostatin (human) Somatostatin-1 Somatotropin release inhibiting factor 38916-34-6 AKOS015994634 CHEBI:64628 Growth hormone release inhibiting factor MFCD00076762 Somatostatin (sheep) Somatostatina [INN-Spanish] Synthetic cyclic growth hormone release-inhibiting factor 55914-64-2 BRD-K14681867-015-01-6 Cyclic Somatostatin H664 NHXLMOGPVYXJNR-ATOGVRKGSA-N Somatostatin [INN:BAN] Somatostatinum UNII-6E20216Q0L 916S346 CB6417646 EINECS 254-186-5 L-alanylglycyl-L-cysteinyl-L-lysyl-L-asparaginyl-L-phenylalanyl-L-phenylalanyl-L-tryptophyl-L-lysyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-cysteine cyclic (3-14) disulfide Somatostatin (pigeon) Somatostatin-14 SR 9357 [ Show all ]
Inchi Key	NHXLMOGPVYXJNR-ATOGVRKGSA-N
Inchi ID	InChI=1S/C76H104N18O19S2/c1-41(79)64(100)82-37-61(99)83-58-39-114-115-40-59(76(112)113)92-72(108)57(38-95)91-75(111)63(43(3)97)94-71(107)54(33-46-23-11-6-12-24-46)90-74(110)62(42(2)96)93-66(102)51(28-16-18-30-78)84-69(105)55(34-47-36-81-49-26-14-13-25-48(47)49)88-68(104)53(32-45-21-9-5-10-22-45)86-67(103)52(31-44-19-7-4-8-20-44)87-70(106)56(35-60(80)98)89-65(101)50(85-73(58)109)27-15-17-29-77/h4-14,19-26,36,41-43,50-59,62-63,81,95-97H,15-18,27-35,37-40,77-79H2,1-3H3,(H2,80,98)(H,82,100)(H,83,99)(H,84,105)(H,85,109)(H,86,103)(H,87,106)(H,88,104)(H,89,101)(H,90,110)(H,91,111)(H,92,108)(H,93,102)(H,94,107)(H,112,113)/t41-,42+,43+,50-,51-,52-,53-,54-,55-,56-,57-,58-,59-,62-,63-/m0/s1
PubChem CID	16129706
ChEMBL	CHEMBL1823872
IUPHAR	N/A
BindingDB	81767
DrugBank	DB09099
Structure SDF download
Lipinski's druglikeness	This ligand has more than 5 hydrogen bond donor. This ligand has more than 10 hydrogen bond acceptor. This ligand is heavier than 500 daltons.

Experimental Data

Parameter	Value	Reference	Database source
	N/A	N/A	DrugBank
EC50	0.065 nM	PMID11266182	ChEMBL
EC50	0.19 nM	PMID15982879	ChEMBL
EC50	0.19 nM	PMID15982879	BindingDB
EC50	65.0 nM	PMID11266182	BindingDB
IC50	0.2 nM	PMID16220980	ChEMBL
IC50	4.2 nM	PMID21806016, PMID24378707	BindingDB,ChEMBL
IC50	10.0 nM	PMID15658865	ChEMBL
Ki	0.12 nM	PMID11520208	ChEMBL
Ki	0.13 nM	PMID10598788, PMID9652348	BindingDB
Ki	0.14 nM	PMID11327607	BindingDB
Ki	0.14 nM	PMID11327607	ChEMBL
Ki	0.15 nM	PMID10598788, PMID15982879, PMID9652348	BindingDB,ChEMBL
Ki	0.2 nM	PMID10433861	BindingDB
Ki	0.23 nM	PMID24342240	ChEMBL
Ki	0.26 nM	PMID15982879	ChEMBL
Ki	0.26 nM	PMID15982879	BindingDB
Ki	0.29 nM	PMID10598788, PMID9652348	BindingDB
Ki	0.3 nM	PMID9650799	BindingDB
Ki	0.32 nM	PMID10818260	BindingDB
Ki	0.3981 nM	PMID12773038	ChEMBL
Ki	0.4 nM	PMID9290757	BindingDB
Ki	0.44 nM	PMID15982879	ChEMBL
Ki	0.44 nM	PMID15982879	BindingDB
Ki	0.71 nM	PMID15982879	ChEMBL
Ki	0.9 nM	PMID7988476	BindingDB
Ki	0.97 nM	PMID10598788	BindingDB
Ki	0.98 nM	PMID9650799	BindingDB
Ki	1.2 nM	PMID8102785	BindingDB
Ki	1.4 nM	PMID16220980	ChEMBL
Ki	1.41 nM	PMID9600011	BindingDB
Ki	>2.0 nM	MedChemComm, (2014) 5:8:1150	ChEMBL
Ki	2.32 nM	PMID9724791, PMID12477342	BindingDB,ChEMBL
Ki	120.0 nM	PMID11266182	BindingDB,ChEMBL
pKD	9.01 -	PMID11448228	ChEMBL

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417