Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Somatostatin receptor type 5
Species	Homo sapiens (Human)
Gene	SSTR5
Synonym	SOMATO SS-5-R SS5-R SS5R SST5 receptor
Disease	N/A
Length	364
Amino acid sequence	MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL
UniProt	P35346
Protein Data Bank	N/A
GPCR-HGmod model	P35346
3D structure model	This predicted structure model is from GPCR-EXP P35346.
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL1792
IUPHAR	359
DrugBank	BE0002147

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
197	CHEMBL363712	C27H29N5S	455.624	4 / 2	5.3	No
640	CHEMBL2112935	C23H21N5	367.456	3 / 2	3.9	Yes
807	CHEMBL406000	C60H74N12O10	1123.33	11 / 12	3.1	No
1285	BIM 23197	C57H81N13O13S3	1252.53	19 / 14	0.0	No
1660	CHEMBL3665855	C27H26F3N3O5	529.516	10 / 1	2.0	No
3018	CHEMBL236787	C28H28FN5	453.565	4 / 2	5.7	No
3833	CHEMBL1079007	C22H27N3O2S	397.537	6 / 2	6.0	No
4281	SCHEMBL673266	C29H33N3O5S	535.659	8 / 1	3.0	No
4675	CHEMBL29102	C33H43NO6	549.708	7 / 1	4.2	No
441927	CHEMBL3350903	C55H68N12O12S2	1153.34	16 / 15	-0.2	No
441933	CHEMBL3350904	C55H68N12O12S2	1153.34	16 / 15	-0.2	No
6424	CHEMBL412183	C55H68N12O12S2	1153.34	16 / 15	-0.2	No
6425	CHEMBL438546	C55H68N12O12S2	1153.34	16 / 15	-0.2	No
7431	CHEMBL1210209	C29H35FN4O3	506.622	7 / 2	4.9	No
7567	CHEMBL451932	C55H74ClN13O10S2	1176.85	14 / 14	3.1	No
9214	CHEMBL1161333	C54H65N11O12S2	1124.3	15 / 13	0.3	No
9220	CHEMBL2093027	C54H65N11O12S2	1124.3	15 / 13	0.3	No
9457	CHEMBL216992	C60H78N12O11S2	1207.48	16 / 14	0.6	No
9586	CHEMBL3665814	C32H32F4N2O6	616.61	11 / 1	3.9	No
10481	CHEMBL2369756	C58H69ClN12O9S2	1177.83	14 / 11	3.8	No
10483	CHEMBL1794041	C58H69ClN12O9S2	1177.83	14 / 11	3.8	No
10538	CHEMBL503379	C41H48F3N7O7S	839.932	12 / 5	N/A	No
10927	CHEMBL92545	C31H34N4O2S	526.699	4 / 2	4.4	No
10933	CHEMBL93618	C31H34N4O2S	526.699	4 / 2	4.4	No
11591	CHEMBL410047	C62H79N13O14S2	1294.51	18 / 16	-1.0	No
11902	CHEMBL391951	C23H29N3O3	395.503	6 / 1	5.0	Yes
12003	CHEMBL502077	C78H101ClN18O18S2	1678.34	25 / 18	-5.4	No
12325	CHEMBL265839	C76H104N16O18S2	1593.88	23 / 21	-0.9	No
12646	CHEMBL3670744	C32H34N4O5	554.647	7 / 1	2.5	No
12825	CHEMBL3665819	C32H35FN2O7	578.637	9 / 1	3.0	No
13080	CHEMBL429166	C60H73ClN12O8S2	1189.89	13 / 11	5.4	No
13367	CHEMBL2011461	C46H60N8O7	837.035	8 / 6	4.3	No
13543	CHEMBL1077722	C21H26N4O3	382.464	7 / 1	3.4	Yes
442226	CHEMBL3350882	C58H72N12O13S2	1209.41	16 / 15	0.2	No
14939	CHEMBL263292	C58H72N12O13S2	1209.41	16 / 15	0.2	No
14959	CHEMBL504838	C35H38F3N5O5	665.714	9 / 5	N/A	No
14967	CHEMBL462020	C35H38F3N5O5	665.714	9 / 5	N/A	No
15209	CHEMBL429164	C84H111N17O18S2	1711.03	23 / 21	0.0	No
15954	CHEMBL254500	C26H30BrN5O2	524.463	4 / 1	3.1	No
15965	CHEMBL252231	C26H30BrN5O2	524.463	4 / 1	3.1	No
16292	BDBM84629	C71H81N11O9	1232.5	11 / 12	8.1	No
17118	CHEMBL406260	C58H70N12O8S2	1127.39	13 / 11	4.0	No
442334	CHEMBL3349676	C58H70N12O8S2	1127.39	13 / 11	4.0	No
17575	CHEMBL3665775	C29H31F3N4O4	556.586	9 / 1	2.4	No
17587	CHEMBL447177	C58H72ClN15O13S2	1286.88	17 / 17	-1.7	No
18094	CHEMBL413888	C81H106N16O17S2	1639.95	22 / 20	0.7	No
18109	CHEMBL238057	C22H27N3O2S	397.537	6 / 1	5.1	No
18213	CHEMBL191171	C24H25N5S2	447.619	5 / 2	4.8	Yes
442385	CHEMBL3349610	C52H71N11O10S2	1074.33	14 / 13	1.9	No
18542	CHEMBL2370299	C52H71N11O10S2	1074.33	14 / 13	1.9	No
18954	CHEMBL3122128	C81H111N17O23S2	1754.99	30 / 19	-9.1	No
19008	SA V	C46H62N8O6	823.052	8 / 8	4.6	No
548116	CHEMBL3974262	C78H100N16O10S	1453.82	14 / 15	6.1	No
557879	BDBM144786	C78H100N16O10S	1453.82	14 / 15	6.1	No
19914	CHEMBL1223226	C51H68N10O10	981.165	12 / 13	1.7	No
20222	CHEMBL393515	C32H33FN4O2	524.64	6 / 1	6.7	No
20634	CHEMBL414544	C57H69N9O11S2	1120.35	15 / 12	2.2	No
20640	CHEMBL2371100	C57H69N9O11S2	1120.35	15 / 12	2.2	No
20643	CHEMBL2371108	C57H69N9O11S2	1120.35	15 / 12	2.2	No
442481	CHEMBL3350357	C57H69N9O11S2	1120.35	15 / 12	2.2	No
20648	CHEMBL414272	C57H69N9O11S2	1120.35	15 / 12	2.2	No
20653	CHEMBL428281	C57H69N9O11S2	1120.35	15 / 12	2.2	No
20660	CHEMBL2111200	C57H69N9O11S2	1120.35	15 / 12	2.2	No
20663	CHEMBL2111257	C57H69N9O11S2	1120.35	15 / 12	2.2	No
20670	CHEMBL264046	C57H69N9O11S2	1120.35	15 / 12	2.2	No
20674	CHEMBL415582	C57H69N9O11S2	1120.35	15 / 12	2.2	No
20735	SCHEMBL671295	C27H31N3O5	477.561	6 / 1	1.4	Yes
20928	CHEMBL236607	C27H28F2N4	446.546	5 / 1	6.1	No
23432	CHEMBL364418	C25H25FN6S	460.575	6 / 2	4.1	Yes
24685	CHEMBL387005	C73H99IN16O15S2	1631.72	20 / 18	1.9	No
25081	CHEMBL384836	C50H67N11O11S2	1062.27	15 / 13	0.4	No
25588	CHEMBL440074	C81H105IN16O17S2	1765.85	22 / 20	1.4	No
26164	CHEMBL176730	C30H31N5	461.613	2 / 3	6.2	No
26237	CHEMBL3665799	C27H27F3N4O4	528.532	9 / 1	1.4	No
26264	CHEMBL1078449	C23H30N4O3	410.518	7 / 2	4.2	Yes
26749	CHEMBL434159	C27H28N6OS	484.622	6 / 2	3.7	Yes
442731	CHEMBL3349599	C56H62N8O8	975.16	9 / 8	5.5	No
27596	CHEMBL409754	C58H70N12O9S2	1143.39	14 / 12	3.6	No
442740	CHEMBL3349669	C58H70N12O9S2	1143.39	14 / 12	3.6	No
28078	sst4-selective analogue 17	C53H62N11O12S2-	1109.26	15 / 13	1.2	No
28611	SA II	C38H54N8O6	718.9	8 / 9	2.6	No
28632	BDBM50136762	C55H67N12O11S2-	1136.33	15 / 11	3.7	No
28799	CHEMBL3665784	C25H23F3N4O4	500.478	9 / 1	0.9	No
28806	CHEMBL2369735	C56H68ClN13O9S2	1166.81	14 / 12	2.6	No
28811	CHEMBL1793861	C56H68ClN13O9S2	1166.81	14 / 12	2.6	No
29010	CHEMBL282129	C42H51N3O5	677.886	7 / 3	6.0	No
442853	CHEMBL3349508	C66H78ClN11O10	1220.87	12 / 13	6.6	No
30542	CHEMBL1793962	C66H78ClN11O10	1220.87	12 / 13	6.6	No
442861	CHEMBL3349506	C66H78ClN11O10	1220.87	12 / 13	6.6	No
30549	CHEMBL1793960	C66H78ClN11O10	1220.87	12 / 13	6.6	No
30746	CHEMBL236609	C28H31FN4	442.582	4 / 1	6.4	No
30916	CHEMBL3122125	C82H126N22O27S2	1916.16	35 / 26	-14.6	No
31426	CHEMBL3665845	C27H25ClFN3O4	509.962	7 / 1	2.6	No
33868	CHEMBL437448	C54H66Br2N12O8S2	1235.13	13 / 11	4.1	No
34846	CHEMBL426072	C25H25N5S	427.57	4 / 2	4.6	Yes
35561	CHEMBL3665764	C28H29ClF2N8O2	583.041	9 / 1	4.3	No
36270	CHEMBL502219	C59H70ClN13O10S2	1220.86	14 / 14	3.2	No
36292	CHEMBL442605	C28H35N5O3	489.62	4 / 4	2.3	Yes
36324	CHEMBL3639647	C28H25ClF3N3O4	559.97	9 / 1	3.1	No
37389	CHEMBL1794043	C60H71N13O9S2	1182.43	14 / 12	3.3	No

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417