Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	D(1B) dopamine receptor
Species	Homo sapiens (Human)
Gene	DRD5
Synonym	Gpcr1 DRD1L2 DRD1B dopamine receptor 5 Dopamine D5 receptor D5 receptor D1beta dopamine receptor D(5) dopamine receptor D(1B) dopamine receptor [ Show all ]
Disease	Solid tumours Schizophrenia
Length	477
Amino acid sequence	MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVLVCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFDIMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNWHRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
UniProt	P21918
Protein Data Bank	N/A
GPCR-HGmod model	P21918
3D structure model	This predicted structure model is from GPCR-EXP P21918.
BioLiP	N/A
Therapeutic Target Database	T46828
ChEMBL	CHEMBL1850
IUPHAR	218
DrugBank	BE0000145, BE0004889

Ligand

Name	NAPTALAM
Molecular formula	C18H13NO3
IUPAC name	2-(naphthalen-1-ylcarbamoyl)benzoic acid
Molecular weight	291.306
Hydrogen bond acceptor	3
Hydrogen bond donor	2
XlogP	3.5
Synonyms	Peach-Thin Caswell No. 592 SCHEMBL54940 DSSTox_RID_78947 WLN: L66J BMVR BVQ HMS1414N13 1-(N-Naphthyl)Phthalamic acid KS-000013CA 2-((1-naphthalenylamino)carbonyl)benzoicacid Mor-Cran 2-[N-(1-naphthylcarbamoyl)]benzoic acid N-1-Naphthalenephthalamic acid acp322 N-Naphthalen-1-yl-phthalamic acid Alanap 10G Naptalam, analytical standard Alanape NPA,(-) Benzoic acid, 2-((1-naphthalenylamino)carbonyl)- Benzoic acid, 2-[(1-naphthalenylamino)carbonyl]- (9CI) Phthalamic acid, N-1-naphthyl- (7CI,8CI) CHEMBL2447888 SR-01000392378-1 EPA Pesticide Chemical Code 030702 IFLab1_001003 112284-33-0 Kyselina N-1-naftylftalamova [Czech] 2-(N-naphthylcarbamoyl)benzoic acid N-(1-naphthalenyl)phthalamic acid 6Q8 N-1-Naphthylphthalamate AJ-08466 Naftalam [Czech] Alanap Plus Naptalame [ISO-French] Ancrack NSC204421 ZINC28113 Oprea1_469302 C18869 RTR-004458 DSSTox_CID_12437 Tox21_302279 FT-0629075 JXTHEWSKYLZVJC-UHFFFAOYSA- 2-((1-naphthalenylamino)carbonyl)-benzoicaci MCULE-3496128683 2-[(1-Naphthylamino)carbonyl]benzoic acid N-(1-Naphthyl)phthalamidic acid ACMC-209bpp N-1-napthylphthalamic acid Alanap alanap10g Nip-a-thin BB0274029 Benzoic acid, 2-((1-naphthalenylamino)carbonyl)- (9CI) Phthalamic acid, N-1-naphthyl CBDivE_002040 Solo (Salt/Mix) DTXSID6032437 HSDB 1742 1-N-Naphthylphthalamic acid KS-00004AUE 2-((1-Naphthalenylamino)carbonylbenzoic acid N - (1 - Naphthyl)phthalamic acid 3-12-00-02876 (Beilstein Handbook Reference) N-1-Naphthyl-phthalamidsaeure AE-017/30049056 N0067 Alanap 10G at Naptalam, PESTANAL(R), analytical standard alpha-Naphthylphthalamic acid NSC 204421 Benzoic acid, 2-[(naphthalenylamino)carbonyl]- Phthalamic acid,N-1-naphthyl- CTK0D2202 ST001288 F0290-1094 InChI=1/C18H13NO3/c20-17(14-9-3-4-10-15(14)18(21)22)19-16-11-5-7-12-6-1-2-8-13(12)16/h1-11H,(H,19,20)(H,21,22) 132-66-1 L001060 2-(naphthalen-1-ylcarbamoyl)benzoic acid N-(1-Naphthyl)phthalamic acid N-1-Naphthylphthalamic acid AK-57895 Naphthalam Alanap-2 Naptro ANW-19451 NSC_8594 [3H]-NPA Peach Thin 322 CAS-132-66-1 SBB008186 DSSTox_GSID_32437 UNII-306R88V86P Grelutin .alpha.-Naphthylphthalamic acid JXTHEWSKYLZVJC-UHFFFAOYSA-N 2-((1-Naphthalenylamino)carbonyl)benzoic acid MolPort-000-389-108 2-[(1-Naphthylamino)carbonyl]benzoic acid # N-.alpha.-Naphthylphthalamic acid ACP 322 N-alpha-Naphthylphthalamic acid Alanap 1 Naptalam [BSI:ISO] alanap10gat NPA (VAN) BDBM81777 Benzoic acid, 2-[(1-naphthalenylamino)carbonyl]- Phthalamic acid, N-1-naphthyl- CHEBI:60833 SR-01000392378 Dyanap I14-18114 1-Naphthylphthalamic acid Kyselina N-1-naftylftalamova 2-(1-Naphthylcarbamoyl)benzoic acid N-(.alpha.-Naphthyl)phthalamic acid 306R88V86P N-1-Naphthyl-phthalamidsaeure [German] AI3-23463 Naftalam Alanap 3 Naptalame Analape NSC-204421 Oprea1_065903 BRN 2814102 Premerge plus (Salt/Mix) Cyanap STK072761 FR-1032 J-006203 132-67-2 (hydrochloride salt) LS-109086 2-[(1-Naphthalenylamino)carbonylbenzoic acid N-(1-Naphthyl)phthalamicAcid AC1L1RBG N-1-Naphthylphthalamidic acid AKOS000485934 Naphthylphthalamic acid alanap1 NCGC00255281-01 ARONIS018728 [ Show all ]
Inchi Key	JXTHEWSKYLZVJC-UHFFFAOYSA-N
Inchi ID	InChI=1S/C18H13NO3/c20-17(14-9-3-4-10-15(14)18(21)22)19-16-11-5-7-12-6-1-2-8-13(12)16/h1-11H,(H,19,20)(H,21,22)
PubChem CID	8594
ChEMBL	N/A
IUPHAR	N/A
BindingDB	81777
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	1136.0 nM	PMID1826762	BindingDB

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417