BioLiP Library

>protein
SFQCSNCSVTETIRWRNIRSKEGIQCNACFIYQRKYNKTRPVTAVNKYQKRKLKVQ

The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2kae:A	56	56	1.0000	1.0000	1.0000	3.89e-36
2	5o9b:A	68	40	0.2857	0.2353	0.4000	8.67e-05
3	2m9w:A	63	43	0.3036	0.2698	0.3953	1.18e-04	8vg0:T, 8vg1:T
4	4hca:A	99	40	0.2857	0.1616	0.4000	2.53e-04	4hc7:B
5	4hca:A	99	41	0.2857	0.1616	0.3902	0.005	4hc7:B
6	4hc7:A	108	40	0.2857	0.1481	0.4000	2.70e-04	3dfv:D, 3dfv:C, 3dfx:A, 3dfx:B, 4hc9:A
7	4hc7:A	108	40	0.2500	0.1296	0.3500	0.005	3dfv:D, 3dfv:C, 3dfx:A, 3dfx:B, 4hc9:A
8	3vd6:C	96	40	0.2679	0.1562	0.3750	4.70e-04	2l6y:A, 2l6z:A, 3vek:C, 3vek:F, 1y0j:A
9	6zfv:A	63	40	0.2500	0.2222	0.3500	0.001	1gnf:A
10	2gat:A	66	41	0.3214	0.2727	0.4390	0.001	1gat:A, 1gau:A, 3gat:A
11	4gat:A	66	41	0.2679	0.2273	0.3659	0.019	5gat:A, 6gat:A, 7gat:A, 2vus:I, 2vus:J, 2vus:K, 2vus:L, 2vus:M, 2vus:N, 2vus:O, 2vus:P, 2vut:I, 2vut:J, 2vut:K, 2vut:L, 2vut:M, 2vut:N, 2vut:O, 2vut:P, 2vuu:I, 2vuu:J, 2vuu:K, 2vuu:L, 2vuu:M, 2vuu:N, 2vuu:O, 2vuu:P
12	8j48:A	38	33	0.2500	0.3684	0.4242	0.034	8j48:D
13	7uch:A	636	25	0.2143	0.0189	0.4800	0.50	6b39:A, 6b3a:A, 6b3b:A
14	1cgt:A	684	34	0.2143	0.0175	0.3529	0.96	1cgu:A, 3cgt:A, 4cgt:A, 5cgt:A, 6cgt:A, 7cgt:A, 8cgt:A, 9cgt:A
15	6wni:A	494	25	0.1786	0.0202	0.4000	1.1	6wni:B, 6wnu:A

[Back]