QPVQQSKRLQQTQAQVEEVVDIMRVNVDKVLERDSKISELDDRADALQAGASQFEASAGKLKRKFW
The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1l4a:A | 66 | 66 | 1.0000 | 1.0000 | 1.0000 | 4.59e-42 | |
2 | 3hd7:A | 91 | 60 | 0.8030 | 0.5824 | 0.8833 | 3.19e-33 | 5w5c:A |
3 | 2dq3:A | 425 | 38 | 0.2424 | 0.0376 | 0.4211 | 0.046 | 2dq3:B |
4 | 8b9w:A | 329 | 40 | 0.2273 | 0.0456 | 0.3750 | 0.94 | 8b9w:B |
5 | 3kyq:A | 193 | 52 | 0.1970 | 0.0674 | 0.2500 | 2.0 | |
6 | 5kr6:B | 460 | 21 | 0.1515 | 0.0217 | 0.4762 | 5.3 | 5kr6:A |
7 | 5hkk:K | 478 | 41 | 0.1970 | 0.0272 | 0.3171 | 6.1 | 5hkk:A, 5hkk:B, 5hkk:C, 5hkk:I, 5hkk:J, 5ik2:A, 5ik2:B, 5ik2:C, 5ik2:I, 5ik2:J, 5ik2:K |
8 | 8t85:A | 335 | 41 | 0.1970 | 0.0388 | 0.3171 | 6.9 | 7lcm:A |
9 | 8j3p:A | 374 | 39 | 0.1515 | 0.0267 | 0.2564 | 8.2 | 8j3o:A, 8j3o:B, 8j3o:C, 8j3o:D, 8j3p:B, 8j3p:C |