MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWC
The query sequence (length=83) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
7alc:I |
85 |
83 |
1.0000 |
0.9765 |
1.0000 |
3.49e-59 |
7al9:A, 7al9:J, 7al9:B, 7al9:I, 7al9:C, 7al9:D, 7al9:E, 7al9:G, 7al9:F, 7al9:H, 7alb:a, 7alb:b, 7alb:c, 7alb:d, 7alb:e, 7alb:f, 7alb:j, 7alb:g, 7alb:h, 7alb:i, 7alb:k, 7alb:l, 7alb:m, 7alb:n, 7alb:o, 7alb:p, 7alb:q, 7alb:r, 7alb:s, 7alb:t, 7alc:F, 7alc:G, 7alc:J, 7alc:H, 1is7:K, 1is7:L, 1is7:M, 1is7:N, 1is7:O, 1is7:P, 1is7:Q, 1is7:R, 1is7:S, 1is7:T, 1is8:K, 1is8:L, 1is8:M, 1is8:N, 1is8:O, 1is8:P, 1is8:Q, 1is8:R, 1is8:S, 1is8:T, 6z80:L, 6z80:K, 6z80:N, 6z80:M, 6z80:O, 6z80:P, 6z80:Q, 6z80:R, 6z80:S, 6z80:T |
2 |
8bd3:B |
504 |
37 |
0.2048 |
0.0337 |
0.4595 |
0.36 |
8bd3:b |
3 |
5l4g:K |
393 |
44 |
0.1566 |
0.0331 |
0.2955 |
2.2 |
8cvt:D, 5gjq:K, 5gjr:K, 5gjr:y, 5m32:e, 6msb:D, 6msd:D, 6mse:D, 6msg:D, 6msh:D, 6msj:D, 6msk:D, 7qxn:D, 7qxp:D, 7qxu:D, 7qxw:D, 7qxx:D, 7qy7:D, 7qya:D, 7qyb:D, 5t0c:AD, 5t0c:BD, 5t0g:D, 5t0h:D, 5t0i:D, 5t0j:D, 5vfp:D, 5vfq:D, 5vfr:D, 5vfs:D, 7w37:D, 7w38:D, 7w39:D, 7w3a:D, 7w3b:D, 7w3c:D, 7w3f:D, 7w3g:D, 7w3h:D, 7w3i:D, 7w3j:D, 7w3m:D, 6wjd:D, 6wjn:D |
4 |
5xnl:B |
503 |
37 |
0.1928 |
0.0318 |
0.4324 |
2.3 |
8c29:B, 8c29:b, 3jcu:B, 3jcu:b, 5mdx:b, 5mdx:B, 7oui:B, 7oui:b, 5xnl:b, 5xnm:B, 5xnm:b, 6yp7:b, 6yp7:B |
5 |
2iw0:A |
226 |
61 |
0.1928 |
0.0708 |
0.2623 |
3.5 |
|
6 |
5dn6:A |
505 |
56 |
0.2048 |
0.0337 |
0.3036 |
4.5 |
5dn6:B, 5dn6:C |
7 |
7l0o:A |
479 |
33 |
0.1807 |
0.0313 |
0.4545 |
7.3 |
7l0o:B, 2woy:A, 2wqs:A, 2wza:A |