BioLiP Library

>protein
MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWC
LH

The query sequence (length=82) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7alc:I	85	82	1.0000	0.9647	1.0000	2.47e-58	7al9:A, 7al9:J, 7al9:B, 7al9:I, 7al9:C, 7al9:D, 7al9:E, 7al9:G, 7al9:F, 7al9:H, 7alb:a, 7alb:b, 7alb:c, 7alb:d, 7alb:e, 7alb:f, 7alb:j, 7alb:g, 7alb:h, 7alb:i, 7alb:k, 7alb:l, 7alb:m, 7alb:n, 7alb:o, 7alb:p, 7alb:q, 7alb:r, 7alb:s, 7alb:t, 7alc:F, 7alc:G, 7alc:J, 7alc:H, 1is7:K, 1is7:L, 1is7:M, 1is7:N, 1is7:O, 1is7:P, 1is7:Q, 1is7:R, 1is7:S, 1is7:T, 1is8:K, 1is8:L, 1is8:M, 1is8:N, 1is8:O, 1is8:P, 1is8:Q, 1is8:R, 1is8:S, 1is8:T, 6z80:L, 6z80:K, 6z80:N, 6z80:M, 6z80:O, 6z80:P, 6z80:Q, 6z80:R, 6z80:S, 6z80:T
2	8bd3:B	504	37	0.2073	0.0337	0.4595	0.37	8bd3:b
3	5l4g:K	393	44	0.1585	0.0331	0.2955	2.2	8cvt:D, 5gjq:K, 5gjr:K, 5gjr:y, 5m32:e, 6msb:D, 6msd:D, 6mse:D, 6msg:D, 6msh:D, 6msj:D, 6msk:D, 7qxn:D, 7qxp:D, 7qxu:D, 7qxw:D, 7qxx:D, 7qy7:D, 7qya:D, 7qyb:D, 5t0c:AD, 5t0c:BD, 5t0g:D, 5t0h:D, 5t0i:D, 5t0j:D, 5vfp:D, 5vfq:D, 5vfr:D, 5vfs:D, 7w37:D, 7w38:D, 7w39:D, 7w3a:D, 7w3b:D, 7w3c:D, 7w3f:D, 7w3g:D, 7w3h:D, 7w3i:D, 7w3j:D, 7w3m:D, 6wjd:D, 6wjn:D
4	5xnl:B	503	37	0.1951	0.0318	0.4324	2.3	8c29:B, 8c29:b, 3jcu:B, 3jcu:b, 5mdx:b, 5mdx:B, 7oui:B, 7oui:b, 5xnl:b, 5xnm:B, 5xnm:b, 6yp7:b, 6yp7:B
5	2iw0:A	226	61	0.1951	0.0708	0.2623	3.1
6	5dn6:A	505	56	0.2073	0.0337	0.3036	4.3	5dn6:B, 5dn6:C
7	6uk3:A	475	46	0.1585	0.0274	0.2826	6.6	6uk3:C, 6uk3:B, 6uk3:D
8	7l0o:A	479	33	0.1829	0.0313	0.4545	7.1	7l0o:B, 2woy:A, 2wqs:A, 2wza:A
9	5na8:A	651	33	0.1341	0.0169	0.3333	9.7	5na6:A, 5na7:A, 5na8:B

[Back]