YSWIEKVLEMGLQDSRKRFILYVASRYLVNVKGVNEDEALQTLKEFYYKLQSGKVYESWLKSVINGVKKKGLLPWSLKRI
EERDKEMYNEIIRVLKNS
The query sequence (length=98) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5of3:C | 107 | 98 | 1.0000 | 0.9159 | 1.0000 | 4.00e-66 | 5of3:F |
2 | 1h1l:B | 519 | 53 | 0.1429 | 0.0270 | 0.2642 | 0.14 | 1h1l:D, 1qgu:B, 1qgu:D, 1qh1:B, 1qh1:D, 1qh8:B, 1qh8:D |
3 | 7k36:I | 599 | 86 | 0.2551 | 0.0417 | 0.2907 | 0.64 | |
4 | 4mbb:A | 184 | 20 | 0.0918 | 0.0489 | 0.4500 | 2.1 | 4nyh:A, 4nyh:B, 4nyh:C |
5 | 3ckl:B | 296 | 61 | 0.2245 | 0.0743 | 0.3607 | 2.3 | 3ckl:A, 2z5f:A, 2z5f:B |
6 | 2x0q:A | 582 | 61 | 0.1939 | 0.0326 | 0.3115 | 2.9 | 2x0p:A |
7 | 4dzt:A | 276 | 17 | 0.0816 | 0.0290 | 0.4706 | 3.1 | |
8 | 8r3g:A | 335 | 25 | 0.1122 | 0.0328 | 0.4400 | 6.0 | 3bxf:A, 3bxg:A, 3bxg:B, 3bxh:A, 3bxh:B, 2okg:B, 7oyk:BBB, 7oyk:AAA, 7oyk:CCC, 7oyk:DDD, 8r3g:B, 8r3g:D, 8r3g:C |
9 | 2zyo:A | 385 | 55 | 0.1531 | 0.0390 | 0.2727 | 6.9 | 2zyk:A, 2zyk:B, 2zyk:C, 2zyk:D, 2zym:A, 2zyn:A |
10 | 4nnr:A | 102 | 67 | 0.1939 | 0.1863 | 0.2836 | 9.1 | 4nnr:B |
11 | 5k1b:A | 264 | 55 | 0.1531 | 0.0568 | 0.2727 | 9.4 |