YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7coh:H | 75 | 75 | 1.0000 | 1.0000 | 1.0000 | 3.50e-54 | 7coh:U, 8h8r:H, 8h8r:U, 8h8s:H, 8h8s:U |
| 2 | 8c8q:J | 75 | 75 | 0.4933 | 0.4933 | 0.4933 | 1.80e-22 | |
| 3 | 4byf:A | 698 | 26 | 0.1600 | 0.0172 | 0.4615 | 0.96 | 4byf:C |
| 4 | 3g5w:A | 318 | 18 | 0.1067 | 0.0252 | 0.4444 | 1.6 | 3g5w:B, 3g5w:C, 3g5w:D, 3g5w:E, 3g5w:F |
| 5 | 6o0e:A | 799 | 38 | 0.1467 | 0.0138 | 0.2895 | 4.2 | |
| 6 | 8d6s:A | 818 | 38 | 0.1467 | 0.0134 | 0.2895 | 4.2 | 8d6s:B, 8d6t:B, 8d6t:A, 8d6u:A, 8d6u:B, 6o0e:B, 6o0f:A, 6o0f:B |
| 7 | 2yeq:A | 522 | 18 | 0.1200 | 0.0172 | 0.5000 | 5.0 | 2yeq:B |
| 8 | 4amw:A | 1025 | 38 | 0.1733 | 0.0127 | 0.3421 | 5.8 | 4amw:B, 4amw:C, 4amw:D, 4amx:A, 4amx:B, 4amx:C, 4amx:D, 2x2i:A, 2x2i:B, 2x2i:C, 2x2i:D, 2x2j:A, 2x2j:B, 2x2j:C, 2x2j:D |
| 9 | 8oq6:A | 336 | 12 | 0.1200 | 0.0268 | 0.7500 | 6.7 | 8op9:A, 8op9:B, 8op9:E, 8op9:C, 8op9:D, 8oq6:B, 8oq6:C, 8oq6:D, 8oq6:E, 8oq7:A, 8oq7:B, 8oq7:C, 8oq7:D, 8oq7:E, 8oq8:A, 8oq8:E, 8oqa:A, 8oqa:B, 8oqa:C, 8oqa:D, 8oqa:E, 8rh4:A, 8rh4:E, 8rh4:B, 8rh4:C, 8rh4:D, 8rh7:E, 8rh7:D, 8rh7:A, 8rh7:B, 8rh7:C, 8rh8:A, 8rh8:B, 8rh8:E, 8rh8:C, 8rh8:D, 8rh9:B, 8rhg:A, 8rhg:E, 8rhg:B, 8rhg:C, 8rhg:D |
| 10 | 7uhy:C | 578 | 19 | 0.1200 | 0.0156 | 0.4737 | 6.8 | |
| 11 | 3lli:A | 251 | 34 | 0.1733 | 0.0518 | 0.3824 | 7.6 | 3llk:A, 3llk:B, 3llk:C |
umich.edu