BioLiP

>protein
YQPVALFIGLRYMRGRAADRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERELQNNILGLMPQAILSSEHGSLNPQQLP
ETAVKLDGVNRVAPITTGDVVLQSARSVAVGVMLGIDPAQKDPLTPYLVNVKQTDLEPGKYNVILGEQLASQLGVNRGDQ
IRVMVPSASQFTPMGRIPSQRLFNVIGTFAANSEVDGYEMLVNIEDASRLMRYPAGNITGWRLWLDEPLKVDSLSQQKLP
EGSKWQDWRDRKGELFQAVRMEKNMMGLLLSLIVAVAAFNIITSLGLMVMEKQGEVAILQTQGLTPRQIMMVFMVQGASA
GIIGAILGAALGALLASQLNNLMPIIGVLLDGAALPVAIEPLQVIVIALVAMAIALLSTLYPSWRAAATQPAE

The query sequence (length=393) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7v8l:C	396	393	1.0000	0.9924	1.0000	0.0	7arh:C, 7arj:C, 7arl:C, 7arm:C, 7mdx:A
2	7arh:E	409	410	0.2774	0.2665	0.2659	7.93e-36	7arl:E, 7mdx:B, 7v8l:E
3	5lil:A	615	393	0.2061	0.1317	0.2061	0.037	5lil:B, 5lj6:A, 5lj7:B
4	8bzx:B	568	160	0.0992	0.0687	0.2437	1.1
5	5ws4:A	650	44	0.0356	0.0215	0.3182	1.7	5ws4:B
6	7w78:B	344	99	0.0687	0.0785	0.2727	2.1	7w7a:B, 7w7a:D, 7w7a:F, 7w7a:H, 7w7b:B, 7w7b:D, 7w7b:F, 7w7b:H, 7w7d:B, 7w7d:D, 7w7d:F, 7w7d:H
7	6nts:B	361	71	0.0534	0.0582	0.2958	4.3
8	7oqh:D	364	44	0.0356	0.0385	0.3182	4.3	7oqh:A, 7oqh:B, 7oqh:C, 7oqh:E, 7oqh:F
9	7dic:A	646	47	0.0458	0.0279	0.3830	4.4	7dcy:A, 7did:A, 7dol:A
10	5lj7:A	592	385	0.1985	0.1318	0.2026	6.3
11	8jwu:C	412	32	0.0356	0.0340	0.4375	6.9	8jwj:A, 8jwj:C, 8jws:A, 8jws:B, 8jws:C, 8jwu:A, 8jwu:B
12	6zj3:Ln	133	37	0.0254	0.0752	0.2703	8.0
13	3o6o:A	209	44	0.0382	0.0718	0.3409	8.0	3o6o:B, 3omu:A, 3omu:B, 3opd:A, 3opd:B, 3opd:C
14	7qde:B	169	23	0.0254	0.0592	0.4348	8.5	7qdd:B
15	8veq:A	325	101	0.0712	0.0862	0.2772	9.8	6vbd:A, 8ven:A, 8vep:A

[Back]