YPANYAKAPRFKALIYYTQHAEEAHVQFAEQATTFFKKLNYGDGFVLDITTDFSKYPYEKLKEYNVIIMLNTSPNTKAER
DAFEQYMENGGGWVGFHAAAYNDKNTHWPWFVKFLGGGVFYCNNWPPQPVLVEVDNEEHPVTKNLPASFVAPASEWYQWT
PSPRQNKDVEVLLSLSPKNYPLGIKDVVNFGDFPIVWSNKNYRMIYLNMGHGDEEFIDGTQNLLLVNAFRWVVSKDKSGN
PFLK
The query sequence (length=244) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4pxy:A | 244 | 244 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 4pxy:B |
2 | 4nna:A | 498 | 92 | 0.0984 | 0.0482 | 0.2609 | 0.12 | 4nnb:A, 4nnc:A |
3 | 4e5v:A | 280 | 152 | 0.1475 | 0.1286 | 0.2368 | 0.58 | 4e5v:B |
4 | 5zxb:B | 241 | 24 | 0.0410 | 0.0415 | 0.4167 | 1.9 | 5zxb:A |
5 | 4nwv:A | 355 | 31 | 0.0574 | 0.0394 | 0.4516 | 2.4 | 4nwv:C, 4nwv:B, 4nww:A, 4nww:B, 4nww:C |
6 | 6lla:B | 363 | 113 | 0.1148 | 0.0771 | 0.2478 | 3.1 | 6lk2:A, 6lk2:B, 6lk2:C, 6lk2:D, 6lla:A, 6lla:C, 6lla:D |
7 | 5hnv:A | 283 | 85 | 0.0779 | 0.0671 | 0.2235 | 3.1 | 5x1q:A, 5x1s:A, 5x1t:A |
8 | 1si8:A | 474 | 61 | 0.0656 | 0.0338 | 0.2623 | 3.6 | 1si8:B, 1si8:C, 1si8:D |
9 | 7r3e:A | 545 | 57 | 0.0574 | 0.0257 | 0.2456 | 5.0 | 8b4a:A, 8b4a:B, 8b4a:C, 8b4a:D, 3dh8:A, 8dq0:C, 8dq0:D, 8dq1:C, 8dq1:D, 5hio:A, 5hip:A, 5hiq:A, 5his:A, 7kgw:A, 7kgx:A, 2q0i:A, 2q0j:A, 2q0j:B, 7r3e:B, 7r3f:A, 7r3j:A, 7r3j:B, 7r3j:C, 7r3j:D, 7tz9:A, 7tza:A, 7u6g:A, 2vw8:A |
10 | 7svt:B | 141 | 56 | 0.0779 | 0.1348 | 0.3393 | 5.6 | |
11 | 8bgw:A | 750 | 46 | 0.0574 | 0.0187 | 0.3043 | 5.7 | 8bgw:B, 6qq5:A, 6qq5:B, 6qq6:A, 6qq6:B, 6t6v:A |
12 | 7b6b:A | 346 | 88 | 0.0984 | 0.0694 | 0.2727 | 7.7 | 7b6b:B |