YNYDEVLEKSILFYEAERSGDLPANNRIPYRGDSALGDQGNQGQDLTGGWYDAGDHVKFGFPMAFATTTLAWGILEFRDG
YEAAGQYNLALDSIRWTLNYFLKAHVSDNEFYGQVGDANTDHAYWGRPEDMTMERPAWSISPSAPGSDLAAETAAALAAG
YLVFRDSDAAFANNLLAHSRTLYDFALNNRGIYSQSISNAAGFYASSAYEDELAWGAAWLYRATEEQEYLDRAYEFGTTT
NTAWAYDWNEKIVGYQLLLTTSAGQTDFLPRVENFLRNWFPGGSVQYTPLGLAWLAQWGPNRYAANAAFIALVSAKYNIL
ASESEQFARSQIHYMLGDAGRSYVVGFGNNPPQQPHHRSSSCPDEPAECDWDEFNQPGPNYQILYGALVGGPDQNDQFED
LRSDYIRNEVANDYNAGFQGAVAALRAIQLRD
The query sequence (length=432) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 3wc3:A | 435 | 432 | 0.9977 | 0.9908 | 0.9977 | 0.0 | 8ihw:A, 8ihx:A, 8ihy:A |
| 2 | 4zg8:A | 426 | 425 | 0.6319 | 0.6408 | 0.6424 | 0.0 | 4zg8:B, 4zh5:A, 4zh5:B |
| 3 | 1ksc:A | 433 | 432 | 0.5648 | 0.5635 | 0.5648 | 2.06e-170 | 1ksd:A |
| 4 | 8u49:A | 615 | 444 | 0.5069 | 0.3561 | 0.4932 | 1.39e-128 | 8u4a:A, 8u4f:A |
| 5 | 1js4:A | 605 | 444 | 0.5069 | 0.3620 | 0.4932 | 1.01e-126 | 1js4:B, 1tf4:A, 1tf4:B, 3tf4:A, 3tf4:B, 4tf4:A, 4tf4:B |
| 6 | 2xfg:A | 446 | 448 | 0.4444 | 0.4305 | 0.4286 | 1.14e-117 | |
| 7 | 4dod:A | 454 | 443 | 0.4468 | 0.4251 | 0.4357 | 9.72e-112 | 4doe:A |
| 8 | 1g87:B | 613 | 442 | 0.4375 | 0.3083 | 0.4276 | 4.46e-107 | 1g87:A, 1ga2:A, 1ga2:B, 1k72:A, 1k72:B, 1kfg:A, 1kfg:B |
| 9 | 7unp:A | 608 | 446 | 0.4398 | 0.3125 | 0.4260 | 2.43e-102 | 7v0i:C, 7v0i:A, 7v0i:B, 7v0j:A, 7v0j:B, 7v0j:C |
| 10 | 1ia7:A | 431 | 435 | 0.3773 | 0.3782 | 0.3747 | 8.81e-91 | 1ia6:A |
| 11 | 2yik:A | 493 | 484 | 0.4074 | 0.3570 | 0.3636 | 1.25e-89 | |
| 12 | 5gxx:A | 600 | 449 | 0.4097 | 0.2950 | 0.3942 | 2.55e-89 | 5gxx:B, 5gxy:A, 5gxy:B, 5gxz:A, 5gxz:B, 5gy0:A, 5gy0:B, 5gy1:A, 5gy1:B |
| 13 | 4cj1:A | 544 | 425 | 0.2454 | 0.1949 | 0.2494 | 2.14e-15 | 4cj0:A, 1clc:A |
| 14 | 3gzk:A | 531 | 469 | 0.2662 | 0.2166 | 0.2452 | 1.70e-13 | 5e2j:A, 5e2j:B, 3ez8:A, 3h2w:A, 3h3k:A, 3rx5:A, 3rx7:A, 3rx8:A |
| 15 | 3x17:B | 548 | 411 | 0.2616 | 0.2062 | 0.2749 | 2.13e-12 | 3x17:A |
| 16 | 1rq5:A | 602 | 427 | 0.2639 | 0.1894 | 0.2670 | 4.64e-12 | |
| 17 | 6dht:A | 547 | 443 | 0.2361 | 0.1865 | 0.2302 | 4.56e-08 | |
| 18 | 5u2o:A | 543 | 360 | 0.2130 | 0.1694 | 0.2556 | 2.95e-07 | |
| 19 | 6fhj:A | 979 | 16 | 0.0278 | 0.0123 | 0.7500 | 0.95 | 6fhn:A |
| 20 | 8gwe:A | 931 | 100 | 0.0579 | 0.0269 | 0.2500 | 5.8 | 7aap:A, 7b3b:A, 7b3c:A, 7b3d:A, 7btf:A, 7bv1:A, 7bv2:A, 7bw4:A, 7bzf:A, 7c2k:A, 7ctt:A, 7cxm:A, 7cxn:A, 7cyq:A, 7d4f:A, 7dfg:A, 7dfh:A, 7doi:A, 7dok:A, 7dte:A, 7ed5:A, 7egq:A, 7egq:N, 7eiz:A, 8gw1:A, 8gwb:A, 8gwf:A, 8gwg:A, 8gwi:A, 8gwk:A, 8gwm:A, 8gwn:A, 8gwo:A, 8gy6:A, 7krn:A, 7kro:A, 7krp:A, 7l1f:A, 6nur:A, 7oyg:A, 7oyg:D, 7ozu:A, 7ozv:A, 7rdx:A, 7rdy:A, 7rdz:A, 7re0:A, 7re1:A, 7re2:A, 7re3:A, 7re3:G, 8sq9:A, 8sqj:A, 8sqk:A, 7uo4:A, 7uo7:A, 7uo9:A, 7uob:A, 7uoe:A, 6xez:A, 6xqb:A, 6yyt:A |
umich.edu