BioLiP

>protein
YLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQR

The query sequence (length=43) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2wtt:L	46	43	1.0000	0.9348	1.0000	3.52e-24	2wqj:K, 2wqj:Z, 2wtt:N, 2wtt:O, 2wtt:P
2	2wqj:C	32	25	0.5814	0.7812	1.0000	4.88e-11
3	4d1l:F	38	33	0.4419	0.5000	0.5758	6.11e-07	4cz5:C, 4cz6:D
4	7bwn:J	280	23	0.2791	0.0429	0.5217	0.14	7bwn:O, 7bwn:C, 7bwn:M, 4gf6:B, 4w74:A, 4w74:B, 4w74:H, 4w74:C, 4w74:D, 4w74:E, 4w76:A, 4w76:B, 4w77:A, 4w77:B, 4w7a:A, 4w7a:B, 4w7c:B, 4w7d:A, 4w7f:A, 4w7r:A, 4w7r:B, 4w7r:C, 4w7r:D
5	4mzr:A	234	23	0.2791	0.0513	0.5217	0.58	4mzr:B, 4mzr:C, 4mzr:D, 3q01:A, 3q01:B, 3q05:A, 3q05:C, 3q05:B, 3q05:D, 3q06:A, 3q06:C, 3q06:D, 3q06:B, 3ts8:A, 3ts8:B, 3ts8:C, 3ts8:D
6	8ka5:A	297	35	0.3023	0.0438	0.3714	1.1	8ka3:A, 8ka4:B, 8ka4:C
7	1rj5:A	259	32	0.3721	0.0618	0.5000	2.1	1rj5:B, 1rj6:A, 1rj6:B
8	7pwd:A	621	42	0.3488	0.0242	0.3571	2.4	6c2y:A, 3cik:A, 5he1:A, 7k7l:A, 3krw:A, 3krx:A, 3pvu:A, 3pvw:A, 5ukk:A, 5wg3:A, 5wg5:A
9	3uzs:A	609	42	0.3488	0.0246	0.3571	3.3	3uzt:A
10	1m1j:B	402	32	0.2791	0.0299	0.3750	3.4	1m1j:E
11	2cd9:A	363	30	0.2093	0.0248	0.3000	4.8	2cd9:B, 2cda:A, 2cda:B, 2cdb:A, 2cdb:B, 2cdb:C, 2cdb:D, 2cdc:A, 2cdc:B, 2cdc:C, 2cdc:D
12	2w8d:B	421	19	0.1860	0.0190	0.4211	7.1	2w8d:A
13	1e6z:B	498	14	0.1860	0.0161	0.5714	9.3	7c34:A, 7c34:B, 7c92:A, 7c92:B, 7cb1:A, 7cb1:B, 1e6r:A, 1e6r:B, 1e6z:A, 1h0g:B, 1h0g:A, 1h0i:A, 1h0i:B, 6jk9:A, 6jk9:B, 6jkf:A, 6jkf:B, 1o6i:A, 1o6i:B, 1ogg:A, 1ogg:B, 1ur8:A, 1ur8:B, 1ur9:A, 1ur9:B, 1w1p:A, 1w1p:B, 1w1t:A, 1w1t:B, 1w1v:A, 1w1v:B, 1w1y:A, 1w1y:B, 3wd1:A, 3wd2:A, 3wd3:A, 3wd4:A, 4z2g:A, 4z2h:A, 4z2i:A, 4z2j:A, 4z2k:A, 4z2l:A

[Back]