YIKPTKVNKNENGVVIDDKTVLAGSTNYYELTWDLDQYKNDRSSADTIQKGFYYVDDYPEEALELRQDLVKITDANGNEV
TGVSVDNYTSLEAAPQEIRDVLSKAGIRPKGAFQIFRADNPREFYDTYVKTGIDLKIVSPMVVKKQMGQTGGSYENQAYQ
IDFGNGYASNIVINNVPKINPKKDVTLTLDPADTNNVDGQTIPLNTVFNYRLIGGIIPANHSEELFEYNFYDDYDQTGDH
YTGQYKVFAKVDIILKNGVIIKSGTELTQYTTAEVDTTKGAITIKFKEAFLRSVSIDSAFQAESYIQMKRIAVGTFENTY
INTVNGVTYSSNTVKTTT
The query sequence (length=338) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6e3f:A | 497 | 331 | 0.9172 | 0.6237 | 0.9366 | 0.0 | 3opu:A, 3opu:B, 3opu:C, 3opu:D, 3opu:E, 3opu:F, 3qe5:A, 3qe5:B |
2 | 4tsh:B | 485 | 331 | 0.9024 | 0.6289 | 0.9215 | 0.0 | |
3 | 7l0o:A | 479 | 331 | 0.6213 | 0.4384 | 0.6344 | 8.43e-155 | 7l0o:B, 2woy:A, 2wqs:A, 2wza:A |
4 | 4ofq:A | 337 | 339 | 0.3609 | 0.3620 | 0.3599 | 7.46e-59 | 4ofq:B |
5 | 8beg:A | 650 | 345 | 0.3077 | 0.1600 | 0.3014 | 3.02e-33 | 8beg:B |
6 | 8beg:A | 650 | 212 | 0.2012 | 0.1046 | 0.3208 | 2.04e-14 | 8beg:B |
7 | 3cuf:A | 314 | 115 | 0.0917 | 0.0987 | 0.2696 | 0.030 | 3cug:A, 3cuh:A, 3cui:A, 3cuj:A, 1exp:A, 1fh7:A, 1fh8:A, 1fh9:A, 1fhd:A, 2his:A, 1j01:A, 2xyl:A |
8 | 7xpi:A | 363 | 95 | 0.0740 | 0.0689 | 0.2632 | 1.8 | 7ytl:A |
9 | 7jil:F | 176 | 63 | 0.0562 | 0.1080 | 0.3016 | 3.8 | |
10 | 2fty:A | 532 | 87 | 0.0651 | 0.0414 | 0.2529 | 5.1 | 2fty:B, 2fty:C, 2fty:D, 2fvk:A, 2fvk:B, 2fvk:C, 2fvk:D, 2fvm:A, 2fvm:B, 2fvm:C, 2fvm:D |
11 | 6za2:B | 1083 | 51 | 0.0503 | 0.0157 | 0.3333 | 5.1 | 6za2:A |
12 | 5b6p:B | 145 | 55 | 0.0562 | 0.1310 | 0.3455 | 5.4 | 5b6p:C, 5b6p:G, 5ydb:A, 5ydb:B, 5ydb:C, 5ydb:D |
13 | 5d2e:A | 485 | 34 | 0.0266 | 0.0186 | 0.2647 | 5.5 | |
14 | 5bqm:C | 443 | 81 | 0.0621 | 0.0474 | 0.2593 | 6.2 | 5bqm:A, 2fpq:A |
15 | 1v47:A | 346 | 61 | 0.0503 | 0.0491 | 0.2787 | 7.1 | 1v47:B |
16 | 3c9f:B | 540 | 54 | 0.0533 | 0.0333 | 0.3333 | 8.5 | 3c9f:A |
17 | 2qyj:A | 154 | 45 | 0.0562 | 0.1234 | 0.4222 | 8.6 |