YGNKESNGEFGNELPQRQFNNRDNRGPPRVRTGEKFGKREFKEEPKEMTLDEWKAIQN
The query sequence (length=58) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4v6w:Ah | 58 | 58 | 1.0000 | 1.0000 | 1.0000 | 3.30e-37 | |
2 | 4v6x:Ah | 73 | 16 | 0.2586 | 0.2055 | 0.9375 | 7.66e-04 | 6z6n:CD |
3 | 7ls1:A | 61 | 12 | 0.1724 | 0.1639 | 0.8333 | 0.47 | 7ls2:A, 6mte:w, 7oyd:w, 8q87:S, 8xsx:CD, 8y0w:S, 8y0x:S, 6z6m:CD |
4 | 7oyc:i2 | 51 | 18 | 0.1724 | 0.1961 | 0.5556 | 0.57 | |
5 | 1qha:A | 903 | 25 | 0.1724 | 0.0111 | 0.4000 | 3.9 | 1bg3:A, 1bg3:B, 1cza:N, 1dgk:N, 4f9o:A, 4f9o:B, 4foe:A, 4foe:B, 4foi:A, 4foi:B, 4fpa:A, 4fpa:B, 4fpb:A, 4fpb:B, 1hkb:A, 1hkb:B, 1hkc:A, 1qha:B |
6 | 6qj3:A | 980 | 18 | 0.1379 | 0.0082 | 0.4444 | 6.5 | 6qj4:A |
7 | 3drw:A | 460 | 56 | 0.2586 | 0.0326 | 0.2679 | 8.3 | 3drw:B |
8 | 4aq0:A | 765 | 28 | 0.1724 | 0.0131 | 0.3571 | 8.4 | 4aq0:B, 2xsg:A, 2xsg:B |
9 | 7oik:A | 4426 | 26 | 0.1897 | 0.0025 | 0.4231 | 9.2 | 7oim:A, 6tax:A, 6tay:A |
10 | 3tm9:A | 146 | 31 | 0.1897 | 0.0753 | 0.3548 | 9.3 | 3tld:A, 3tld:B, 3tm3:A, 1vhb:A, 1vhb:B, 2vhb:A, 2vhb:B, 3vhb:A, 3vhb:B, 4vhb:A, 4vhb:B |