BioLiP

>protein
YFDSHLHSEGLGFSELVKLKENGIKEVCSLAFFPVKPKYPQTMIDVFRKLTEFEPLRCEAAGVKMHPAVGIHPRCIPPDY
EFVLGYLEEGEWVAFGEIGLELVTDEEIEVLKSQLELAKRMDVPCIIHTPRGNKLKATRKTLEILESLDFPADLAVIDHV
NFETLDMVLETEYWIGLTVQDAARIVAEHGERFMLNSDAGYRVAEAAVKIEEAVGREEMEKVARENARKFLRV

The query sequence (length=233) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3guw:A	233	233	1.0000	1.0000	1.0000	1.74e-173	3guw:B, 3guw:C, 3guw:D
2	1zzm:A	259	78	0.1159	0.1042	0.3462	5.50e-05
3	2y1h:B	265	94	0.1116	0.0981	0.2766	0.010	2y1h:A
4	1yix:A	265	225	0.2275	0.2000	0.2356	0.32	1yix:B
5	6i5s:A	445	152	0.1631	0.0854	0.2500	0.52
6	7po9:A	88	32	0.0515	0.1364	0.3750	0.52	7po9:B
7	7c86:A	296	88	0.0944	0.0743	0.2500	2.2	6csn:A, 6cso:A, 7e6x:A, 7e6y:A, 7e6z:A, 7e70:A, 7e71:A, 3ug9:A, 4yzi:A
8	5myj:BP	134	50	0.0730	0.1269	0.3400	2.8
9	5vkw:B	469	28	0.0515	0.0256	0.4286	3.8
10	6k0b:C	231	24	0.0472	0.0476	0.4583	6.5	6k0a:D, 6k0b:D
11	4wtr:A	266	59	0.0687	0.0602	0.2712	6.7	4wts:A
12	4o30:A	217	30	0.0515	0.0553	0.4000	6.8	4o30:B, 5va6:A, 5va6:B, 5vac:A, 5vah:A, 5vah:B, 5vbc:A, 5vbc:B
13	3if2:A	437	88	0.1030	0.0549	0.2727	8.4	3if2:B
14	7sbw:B	1196	41	0.0558	0.0109	0.3171	9.4	6nzk:A, 6nzk:B, 6nzk:C, 7sb3:J, 7sb3:A, 7sb3:B, 7sb4:A, 7sb4:C, 7sb4:B, 7sbv:J, 7sbv:A, 7sbv:B, 7sbw:J, 7sbw:A, 7sbx:J, 7sbx:B, 7sbx:A, 7sby:J, 7sby:A, 7sby:B

[Back]