YAFKIPLSIRQKICSSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKASPTGVILDLWEARQQDGDLNSLASALEEMGKSE
MLVAMATD
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 1wmg:C | 88 | 88 | 1.0000 | 1.0000 | 1.0000 | 9.74e-62 | 1wmg:D, 1wmg:E |
| 2 | 4bvq:A | 364 | 38 | 0.1818 | 0.0440 | 0.4211 | 0.11 | 4bvq:B, 4bvr:A, 4bvr:B, 4bvs:A, 4bvs:B, 4bvt:A, 4bvt:B |
| 3 | 3c8v:C | 465 | 31 | 0.1364 | 0.0258 | 0.3871 | 1.6 | |
| 4 | 3kfl:A | 530 | 54 | 0.1591 | 0.0264 | 0.2593 | 2.0 | 6swx:A |
| 5 | 4eg7:B | 536 | 65 | 0.1818 | 0.0299 | 0.2462 | 3.6 | 6cml:A, 6cml:B, 4eg1:A, 4eg1:B, 4eg3:A, 4eg3:B, 4eg4:A, 4eg5:A, 4eg6:A, 4eg7:A, 4eg8:A, 4eg8:B, 4ega:A, 4ega:B, 5j58:A, 5j58:B, 5j59:A, 5j59:B, 5j5a:A, 5j5a:B, 6mes:A, 6mes:B, 4mvw:A, 4mvw:B, 4mvx:A, 4mvx:B, 4mvy:A, 4mvy:B, 4mw0:A, 4mw0:B, 4mw1:A, 4mw1:B, 4mw2:A, 4mw2:B, 4mw4:A, 4mw4:B, 4mw5:A, 4mw5:B, 4mw6:A, 4mw6:B, 4mw7:A, 4mw7:B, 4mw9:A, 4mw9:B, 4mwb:A, 4mwb:B, 4mwc:A, 4mwc:B, 4mwd:A, 4mwd:B, 4mwe:A, 4mwe:B, 5nfh:A, 5nfh:B, 5tqu:A, 5v49:A, 5v49:B, 4zt2:A, 4zt2:B, 4zt3:A, 4zt3:B, 4zt4:A, 4zt4:B, 4zt5:A, 4zt5:B, 4zt6:A, 4zt6:B, 4zt7:A, 4zt7:B |
| 6 | 4eg6:B | 515 | 65 | 0.1818 | 0.0311 | 0.2462 | 3.8 | 4eg4:B, 4eg5:B, 5tqu:B |
| 7 | 1fwx:A | 591 | 36 | 0.1477 | 0.0220 | 0.3611 | 5.3 | 1fwx:B, 1fwx:C, 1fwx:D, 2iwf:A, 2iwf:B, 2iwk:A, 2iwk:B |
| 8 | 8iab:A | 704 | 55 | 0.1591 | 0.0199 | 0.2545 | 5.5 | 8iab:B, 8iad:A, 8iad:B, 7xa9:A, 7xa9:B |
| 9 | 7szv:A | 372 | 25 | 0.1364 | 0.0323 | 0.4800 | 7.9 | 7szv:B |
zhanggroup.org