BioLiP

>protein
WVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK

The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3a0b:E	82	65	1.0000	0.7927	1.0000	8.46e-44	3a0b:e, 3a0h:E, 3a0h:e, 2axt:E, 2axt:e, 5b5e:E, 5b5e:e, 5b66:E, 5b66:e, 7cji:E, 7cji:e, 7cjj:E, 7cjj:e, 7cou:E, 7cou:e, 7czl:e, 7czl:E, 7d1t:E, 7d1t:e, 7d1u:E, 7d1u:e, 6dhe:E, 6dhe:e, 6dhf:E, 6dhf:e, 6dhg:E, 6dhg:e, 6dhh:E, 6dhh:e, 6dho:E, 6dho:e, 6dhp:E, 6dhp:e, 7dxa:e, 7dxh:e, 5e79:E, 5e79:e, 5e7c:E, 5e7c:e, 7eda:E, 9evx:E, 9evx:e, 8ez5:E, 8ez5:e, 8f4c:E, 8f4c:e, 8f4d:E, 8f4d:e, 8f4e:E, 8f4e:e, 8f4f:E, 8f4f:e, 8f4g:E, 8f4g:e, 8f4h:E, 8f4h:e, 8f4i:E, 8f4i:e, 8f4j:E, 8f4j:e, 8f4k:E, 8f4k:e, 4fby:E, 4fby:R, 8gn0:E, 8gn0:e, 8gn1:E, 8gn1:e, 8gn2:E, 8gn2:e, 5gth:E, 5gth:e, 5gti:E, 5gti:e, 5h2f:E, 5h2f:e, 4il6:E, 4il6:e, 8ir5:E, 8ir5:e, 8ir6:E, 8ir6:e, 8ir7:E, 8ir7:e, 8ir8:E, 8ir8:e, 8ir9:E, 8ir9:e, 8ira:E, 8ira:e, 8irb:E, 8irb:e, 8irc:E, 8irc:e, 8ird:E, 8ird:e, 8ire:E, 8ire:e, 8irf:E, 8irf:e, 8irg:E, 8irg:e, 8irh:E, 8irh:e, 8iri:E, 8iri:e, 4ixq:E, 4ixq:e, 4ixr:E, 4ixr:e, 1izl:E, 6jlj:E, 6jlj:e, 6jlk:E, 6jlk:e, 6jll:E, 6jll:e, 6jlm:E, 6jlm:e, 6jln:E, 6jln:e, 6jlo:E, 6jlo:e, 6jlp:E, 6jlp:e, 5kaf:E, 5kaf:e, 5kai:E, 5kai:e, 3kzi:E, 5mx2:E, 5mx2:e, 7nho:E, 7nhp:E, 7nhq:E, 4pbu:E, 4pbu:e, 4pj0:E, 4pj0:e, 7rf1:E, 7rf1:e, 7rf2:E, 7rf2:e, 7rf3:E, 7rf3:e, 7rf4:E, 7rf4:e, 7rf5:E, 7rf5:e, 7rf6:E, 7rf6:e, 7rf7:E, 7rf7:e, 7rf8:E, 7rf8:e, 4rvy:E, 4rvy:e, 1s5l:E, 1s5l:e, 5tis:E, 5tis:e, 4tnh:E, 4tnh:e, 4tni:E, 4tni:e, 4tnj:E, 4tnj:e, 4tnk:E, 4tnk:e, 4ub6:E, 4ub6:e, 4ub8:E, 4ub8:e, 5v2c:E, 5v2c:e, 4v62:AE, 4v62:BE, 4v82:AE, 4v82:BE, 6w1o:E, 6w1o:e, 6w1p:E, 6w1p:e, 6w1q:E, 6w1q:e, 6w1r:E, 6w1r:e, 6w1t:E, 6w1t:e, 6w1u:E, 6w1u:e, 6w1v:E, 6w1v:e, 1w5c:E, 1w5c:K, 5ws5:E, 5ws5:e, 5ws6:E, 5ws6:e, 3wu2:E, 3wu2:e, 7yq2:E, 7yq2:e, 7yq7:E, 7yq7:e, 5zzn:E, 5zzn:e
2	7ymi:E	65	60	0.6308	0.6308	0.6833	8.78e-30	7ymi:e, 7ymm:1E, 7ymm:2E, 7ymm:3E, 7ymm:4E
3	6jlu:E	79	58	0.6154	0.5063	0.6897	1.28e-29	8iwh:e, 8iwh:E, 6j3y:E, 6j3y:e, 6j3z:E, 6j3z:e, 6j40:E, 6j40:e, 8j5k:E, 8j5k:e, 6jlu:e, 7vd5:E, 7vd5:e, 8wb4:E, 8wb4:e, 8xlp:e, 8xlp:E, 8xr6:E, 8xr6:e, 7y5e:EL, 7y5e:E6, 7y5e:e6, 7y5e:eL, 7y7a:E9, 7y7a:e9, 7y7a:EE, 7y7a:eE, 7y7a:EO, 7y7a:eO, 7y7a:EZ, 7y7a:eZ, 7y7a:Em, 7y7a:em
4	8kde:E	78	58	0.6462	0.5385	0.7241	5.20e-29	8zee:E
5	8bd3:E	81	62	0.6462	0.5185	0.6774	7.11e-29	8bd3:e, 6kac:E, 6kac:e, 6kad:E, 6kad:e, 6kaf:E, 6kaf:e, 7pi0:E, 7pi0:e, 7pi5:E, 7pi5:e, 7pin:E, 7pin:e, 7pin:E1, 7pin:e1, 7piw:E, 7piw:e, 7piw:E1, 7piw:e1, 7pnk:E, 7pnk:e, 8r2i:E
6	4yuu:E1	61	58	0.6000	0.6393	0.6724	7.11e-29	4yuu:e1, 4yuu:e2
7	8wql:ED	78	61	0.6154	0.5128	0.6557	2.44e-28	8wql:EE, 8wql:E1, 8wql:e1, 8wql:eD, 8wql:eE
8	3jcu:E	79	60	0.6154	0.5063	0.6667	5.07e-28	8c29:E, 8c29:e, 3jcu:e, 5mdx:e, 5mdx:E, 7oui:E, 7oui:e, 5xnl:E, 5xnl:e, 5xnm:E, 5xnm:e, 6yp7:e, 6yp7:E
9	7n8o:E	78	60	0.5846	0.4872	0.6333	1.19e-26	8am5:E, 8asl:E, 7n8o:e, 7rcv:E, 7rcv:e, 8tow:E, 8tow:e, 6wj6:E
10	8eqm:E	48	52	0.5692	0.7708	0.7115	5.88e-22	8eqm:e, 7sa3:E
11	8k0e:A	646	38	0.2308	0.0232	0.3947	0.59	8k0f:A, 8k0m:A, 8k17:A, 8kc9:A
12	5tky:A	597	18	0.1231	0.0134	0.4444	2.3	5tky:B
13	8qby:M	503	31	0.1846	0.0239	0.3871	3.2	8qc1:M
14	3vvp:A	420	27	0.1692	0.0262	0.4074	3.3
15	5hgq:B	482	24	0.1846	0.0249	0.5000	4.2	5hgq:A, 5hgq:D, 5hgq:C
16	8c7f:A	772	27	0.1692	0.0142	0.4074	6.1	7zb3:A, 7zb3:B, 7zdy:W, 7zdy:Y, 7zgz:Y
17	3wbn:A	450	23	0.1538	0.0222	0.4348	7.3	3vvr:A, 3vvs:A
18	8e73:G2	258	34	0.1846	0.0465	0.3529	7.7	6x89:G2
19	8oo0:C	78	14	0.1231	0.1026	0.5714	8.3
20	1yq3:B	242	35	0.1538	0.0413	0.2857	8.8	2fbw:B, 2fbw:O, 8gs8:B, 2h88:B, 2h88:O, 2h89:B, 6myo:B, 6myp:B, 6myq:B, 6myr:B, 6mys:B, 6myt:B, 6myu:B, 2wqy:B, 2wqy:O, 1yq4:B

[Back]