WLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQWTKYEEDKSYLE
PYLKEVIRERKEREEWAKK
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7dgq:A2 | 106 | 99 | 0.9899 | 0.9245 | 0.9899 | 1.94e-68 | 2a06:F, 2a06:S, 1pp9:F, 1pp9:S, 1ppj:F, 1ppj:S |
2 | 8c81:C | 561 | 19 | 0.1010 | 0.0178 | 0.5263 | 0.86 | 8c80:C, 8c82:C, 8c82:G, 8iaj:B, 8iaj:F, 8iak:B, 8iak:F, 8iam:B, 8iam:F, 8qof:C, 8qof:G, 8qog:C |
3 | 8b64:M | 304 | 23 | 0.1010 | 0.0329 | 0.4348 | 4.8 | 7yml:M |
4 | 5naq:A | 461 | 38 | 0.1212 | 0.0260 | 0.3158 | 5.2 | 5naq:B, 5naq:C, 5naq:D, 5naq:E, 5naq:F |
5 | 5ktk:A | 452 | 34 | 0.0909 | 0.0199 | 0.2647 | 5.3 | |
6 | 5tkm:A | 184 | 28 | 0.1111 | 0.0598 | 0.3929 | 7.5 | 5tkm:B |
7 | 6pvg:A | 445 | 33 | 0.1111 | 0.0247 | 0.3333 | 9.0 | 6pvf:A, 6pvh:A, 6pvi:A, 6pvj:A |