WINEAAFRQEGVAVLLCVVIAAWLDVDAVTRVLLISSVMLVMIVELLNSAIEAVVDRIGSEYHELSGRAKDLGSAAVLIA
IIDAVITWAILLWSH
The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4bpd:A | 118 | 95 | 1.0000 | 0.8051 | 1.0000 | 1.27e-60 | 4bpd:C, 4bpd:D, 4brb:A, 4brb:B, 4brb:C, 4brb:D, 4brr:B, 4brr:D, 4ck0:C, 4ck0:B, 4d2e:A, 4d2e:B, 4d2e:C, 4d2e:D, 4d2e:E, 5d56:A, 5d56:B, 5d56:D, 5d56:C, 5d57:A, 5d57:B, 5d57:D, 5d57:C, 5dwk:A, 5dwk:B, 5dwk:C, 5dwk:D, 4uxx:C, 4uxx:B, 4uxz:A, 4uxz:B, 4uxz:D, 4uyo:A, 4uyo:B, 4uyo:D, 4uyo:C, 4uyo:F, 3ze3:A, 3ze3:B, 3ze3:C, 3ze3:D |
2 | 4by9:F | 366 | 32 | 0.1789 | 0.0464 | 0.5312 | 0.24 | 4by9:I, 4by9:C, 4by9:L, 3nmu:A, 3nmu:B, 3nvi:A, 3nvi:C, 3nvk:A, 3nvk:F |
3 | 4cj8:H | 247 | 20 | 0.0842 | 0.0324 | 0.4000 | 6.8 | 4ayj:B, 4ayj:A, 4ayj:C, 4ayj:D, 4cj8:A, 4cj8:B, 4cj8:C, 4cj8:D, 4cj8:E, 4cj8:F, 4cj8:G, 4cj8:I, 4cj8:J, 4cj8:K, 4cj8:L, 4cj8:M, 4cj8:N, 4cj8:O, 4cj8:P, 4cjc:A, 4cjc:B, 4cjc:C, 4cjc:D |
4 | 4ayl:A | 210 | 20 | 0.0842 | 0.0381 | 0.4000 | 9.7 |