Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
WFEVLPGIAVMGVCLFIPGMATARIHRFSNGGREKRVAHYSYQWYLMERDRRVSGVNRYYVSKGLENID

The query sequence (length=69) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 5lnk:z 69 69 1.0000 1.0000 1.0000 5.23e-48
2 2ynp:A 601 47 0.2464 0.0283 0.3617 0.47 8ens:A, 8enw:A, 8enw:B, 8enx:A, 8hqt:A, 8hqv:A, 8hqx:A, 4j73:A, 4j77:A, 4j77:B, 4j78:A, 4j79:A, 4j81:B, 4j81:A, 4j82:A, 4j82:B, 4j84:A, 4j84:B, 4j86:A, 4j86:B, 2ynn:A
3 4j75:A 374 45 0.2029 0.0374 0.3111 1.3 4j75:B, 4jfa:A, 4jfa:B, 4jfa:D
4 4ag5:A 374 32 0.1594 0.0294 0.3438 1.7 4ag5:B, 4ag5:C
5 4ag5:D 270 32 0.1594 0.0407 0.3438 2.1
6 4omf:G 231 30 0.1594 0.0476 0.3667 3.0 4ci0:B, 3zfs:B
7 7uoo:4 538 30 0.1739 0.0223 0.4000 3.4 6ft6:4, 3jct:4, 6m62:4, 6rzz:r, 7uqb:4, 7uqz:4, 7v08:4, 6ylg:4, 6ylh:4
8 8hfr:pT 580 30 0.1739 0.0207 0.4000 3.4 5apn:x, 5apo:x, 7z34:4
9 4ki0:F 490 49 0.2174 0.0306 0.3061 4.6 4khz:F, 3puv:F, 3puw:F, 3pux:F, 3puy:F, 3puz:F, 3pv0:F, 2r6g:F, 3rlf:F
10 8jgj:A 684 34 0.1594 0.0161 0.3235 5.6 8jgj:B, 8jgk:A, 8jgk:B, 8jgl:A, 8jgl:B, 8jgv:A, 8jgv:B
11 6iq5:B 437 32 0.1594 0.0252 0.3438 5.7
12 1pzw:A 80 37 0.1594 0.1375 0.2973 5.9
13 4v7f:l 380 28 0.1594 0.0289 0.3929 6.0 5jcs:u, 4v8t:t
14 6tz8:B 174 37 0.1739 0.0690 0.3243 6.1 6tz8:E
15 6iq5:A 459 32 0.1594 0.0240 0.3438 6.2 3pm0:A
16 8jev:A 556 34 0.1594 0.0198 0.3235 6.4 8jev:B
17 6jj7:A 465 25 0.1594 0.0237 0.4400 7.0 6jj7:C, 6jj7:E, 6jj8:C, 6jj8:A, 6jj8:B, 6jj9:C, 6jj9:A, 6jj9:E, 5zqt:A, 5zqt:B, 5zqt:C
18 3pe7:A 376 23 0.1304 0.0239 0.3913 7.1
19 3sef:C 244 50 0.2319 0.0656 0.3200 7.2
20 3pgj:A 272 50 0.2319 0.0588 0.3200 7.3 3pgj:B, 3pgj:C, 3pgj:D, 3sef:A, 3sef:B
21 4jfa:C 348 43 0.1449 0.0287 0.2326 8.3

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417