VYGVMAEFPTPEALIEATRKAKAAGYTKMDAFSPFPIEEVIEEIAHGDTGVPRLVLLFGLIGAASGFILQYIGNLVDYPL
NVGGRPLDITNWPAMIPITFESGILLASFAAAIGMIVLNGLPSPYHPVFNVPRFQYASQDAFFLCIEATDPLFDRSRTSQ
FLRSLNPMQVSEVAY
The query sequence (length=175) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8k9e:D | 175 | 175 | 1.0000 | 1.0000 | 1.0000 | 6.89e-128 | 8k9f:D, 8x2j:D |
2 | 6loe:D | 174 | 173 | 0.5200 | 0.5230 | 0.5260 | 6.21e-55 | |
3 | 7v1v:A | 447 | 61 | 0.1029 | 0.0403 | 0.2951 | 4.9 | 7v1v:F, 7v1v:B, 7v1v:E, 7v1v:C, 7v1v:D, 7v1w:A, 7v1w:C, 7v1w:B, 7v1w:D, 7v1w:E, 7v1w:F, 7v1x:A, 7v1x:D, 7v1x:B, 7v1x:C, 7v1x:F, 7v1x:E |
4 | 5c4i:A | 394 | 80 | 0.1086 | 0.0482 | 0.2375 | 5.3 | 5c4i:D, 5exd:A, 5exd:D, 5exd:G, 5exd:J, 5exe:A, 5exe:D |
5 | 3loo:B | 341 | 32 | 0.0686 | 0.0352 | 0.3750 | 5.7 | 3loo:A, 3loo:C |
6 | 6xhi:A | 473 | 53 | 0.0914 | 0.0338 | 0.3019 | 6.1 | 4xcg:B, 6xhj:A |
7 | 4xcd:A | 507 | 53 | 0.0914 | 0.0316 | 0.3019 | 6.3 | 4xcd:B, 4xcd:C, 4xcd:D, 4xcd:E, 4xcd:F |
8 | 4am2:A | 159 | 22 | 0.0686 | 0.0755 | 0.5455 | 6.4 | 4am2:B, 4am4:A, 4am4:B, 4am5:A, 4am5:B |
9 | 1d5a:A | 733 | 32 | 0.0629 | 0.0150 | 0.3438 | 9.0 | |
10 | 6gu2:A | 294 | 84 | 0.1257 | 0.0748 | 0.2619 | 9.3 | 6gu3:A, 6gu4:A, 6gu6:A, 6gu7:A, 5hq0:A, 5lqf:A, 5lqf:D, 4y72:A |