BioLiP

>protein
VYFDLEDLGNTTGQWDLYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSTLAYFSATASGDILPIKKGPQLP
PQLGPRLG

The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6yez:H	93	88	1.0000	0.9462	1.0000	5.62e-59	7dkz:H, 5l8r:H, 3lw5:H, 4rku:H, 4y28:H, 6yac:H, 6zoo:H, 6zxs:H
2	4xk8:H	90	86	0.8864	0.8667	0.9070	6.59e-52	4xk8:h
3	7wfd:AH	95	86	0.8409	0.7789	0.8605	1.32e-50	8j6z:H, 8j7a:H, 8j7b:H, 2o01:H, 7wfe:BH, 7wg5:AH, 2wsc:H, 2wse:H, 2wsf:H
4	8htu:H	95	86	0.6250	0.5789	0.6395	1.14e-37	7ksq:H, 7kux:H, 6l35:H, 7xqp:H
5	5zji:H	95	75	0.7500	0.6947	0.8800	1.52e-31	8bcv:H, 8bcw:H
6	8wgh:H	90	75	0.7045	0.6889	0.8267	4.04e-31
7	6zzx:H	94	85	0.4545	0.4255	0.4706	5.16e-21	6zzy:H
8	6sl5:H	92	81	0.3977	0.3804	0.4321	5.30e-14
9	7d0j:H	100	85	0.3636	0.3200	0.3765	5.58e-14	7dz7:H, 7dz8:H, 8h2u:H, 6ijo:H
10	7yca:H	96	87	0.4432	0.4062	0.4483	7.66e-13
11	6igz:H	88	86	0.4205	0.4205	0.4302	8.40e-13
12	6tq4:A	297	34	0.1591	0.0471	0.4118	0.34	6tq6:A
13	6tp3:A	314	34	0.1591	0.0446	0.4118	0.34	6to7:A, 6to7:B, 6tod:A, 6tod:B, 6tos:A, 6tos:B, 6tot:A, 6tot:B, 6tp3:B, 6tp4:A, 6tp4:B, 6tp6:A, 6tp6:B, 6tq4:B, 6tq6:B, 6tq7:A, 6tq7:B, 6tq9:A, 6tq9:B
14	7xrr:A	309	34	0.1591	0.0453	0.4118	0.36	7l1u:R, 7l1v:R, 7sqo:R, 7sr8:R
15	5why:A	418	64	0.2159	0.0455	0.2969	0.56
16	6v9s:A	503	33	0.1591	0.0278	0.4242	0.58	4zj8:A, 4zjc:A
17	6tpn:A	510	31	0.1477	0.0255	0.4194	0.80	4s0v:A, 6tpg:A, 6tpj:A, 6tpj:B, 5wqc:A, 5ws3:A
18	4x28:A	386	45	0.1932	0.0440	0.3778	4.3	4x28:B
19	5i4e:A	959	21	0.1250	0.0115	0.5238	4.7
20	7l0b:A	202	27	0.1250	0.0545	0.4074	5.2	7l0b:B, 7l0b:C, 7l0b:D
21	5t04:A	458	19	0.1023	0.0197	0.4737	5.5	4grv:A
22	5v1d:D	247	64	0.2045	0.0729	0.2812	6.4	5v1d:C
23	5v1d:A	193	90	0.3068	0.1399	0.3000	9.3

[Back]