VVKVGHKASYDAELRERLLELPHPKSGPKPRIEWVAPPRLADISKETAELKRQYGFFECSKFLACGEECGLDQEARELIL
NEYARDREFEFRNGGWIQRYTVASHKPATQKILPLPASAPLARELLMLIARSTTQAGKVLHSDNTSILAVPVMRDSGKHS
KRRPTASTHHLVVGLSKPGCEHDFEFDGYRAAVHVMHLDPKQSANIGEQDFVSTREIYKLDMLELPPISRKGDLDRASGL
ETRWDVILLLECLDSTRVSQAVAQHFNRHRLALSVCKDEFRKGYQLASEIRGTIPLSSLYYSLCAVRLRMTVHPF
The query sequence (length=315) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8psn:A | 417 | 315 | 1.0000 | 0.7554 | 1.0000 | 0.0 | 8pso:A, 8psq:A, 8pss:A, 8psu:A, 8psx:A, 8psz:A, 8pt2:A, 8pt6:A, 8pt7:A, 8pth:A, 8ptj:A, 8qz8:A |
2 | 3bje:A | 327 | 147 | 0.1079 | 0.1040 | 0.2313 | 5.4 | 3bje:B |
3 | 8b1n:B | 410 | 57 | 0.0540 | 0.0415 | 0.2982 | 6.6 | |
4 | 4zkf:A | 462 | 52 | 0.0603 | 0.0411 | 0.3654 | 8.0 | 4z2b:A |
5 | 1hkv:A | 446 | 77 | 0.0698 | 0.0493 | 0.2857 | 8.0 | 1hkv:B |
6 | 1o7d:A | 291 | 66 | 0.0571 | 0.0619 | 0.2727 | 8.3 | |
7 | 8b1n:A | 433 | 57 | 0.0540 | 0.0393 | 0.2982 | 8.7 | 8byh:A, 8byh:B, 8ri0:A, 8ri0:B |