VSVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVLYSQLLQAY
KWSNKLQYHAGLASGLLNQQSLKRSANQLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLVTLGKVLKVIVVMRS
LFIDRTIVKGYNENVYTEDLDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFL
QDGLPPTWRDFRTLEAFHDTCRQ
The query sequence (length=263) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7emf:0 | 267 | 267 | 0.9962 | 0.9813 | 0.9813 | 0.0 | 7enj:0, 8gxq:c, 8gxs:c, 7nvr:p |
2 | 7d62:A | 294 | 57 | 0.0798 | 0.0714 | 0.3684 | 0.012 | 7d62:B |
3 | 3vgi:A | 270 | 75 | 0.0760 | 0.0741 | 0.2667 | 0.045 | 3wq0:A, 3wq1:A, 3wq7:A, 3wq7:B, 3wr0:A, 3wt3:A, 3wt3:B, 3wxp:A, 3wy6:A |
4 | 3st7:A | 369 | 117 | 0.0951 | 0.0678 | 0.2137 | 0.57 | 2zkl:A |
5 | 4yrd:B | 346 | 117 | 0.0951 | 0.0723 | 0.2137 | 0.69 | 3vhr:A, 4yrd:A |
6 | 8xku:A | 730 | 138 | 0.1217 | 0.0438 | 0.2319 | 5.1 | 8xkv:A |
7 | 8hky:S27A | 54 | 36 | 0.0456 | 0.2222 | 0.3333 | 5.6 | 8hkz:S27A, 8hl1:S27A, 8hl2:S27A, 8hl3:S27A, 8hl4:S27A, 8hl5:S27A, 8wkp:S27A, 8wq2:S27A, 8wq4:S27A |
8 | 1s6i:A | 182 | 100 | 0.0875 | 0.1264 | 0.2300 | 6.4 |