VSVESSWRYIDTQGQIHGPFTTQMMSQWYIGGYFASTLQISRLGSTPETLGINDIFITLGELMTKLEKYDTDPFTTFDKL
HVQTT
The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3fma:C | 86 | 85 | 1.0000 | 0.9884 | 1.0000 | 5.44e-59 | 3fma:A, 3fma:B, 3fma:D, 3fma:E |
2 | 7ruq:A | 63 | 59 | 0.2824 | 0.3810 | 0.4068 | 2.34e-10 | 7ruq:C |
3 | 7rup:A | 63 | 59 | 0.2471 | 0.3333 | 0.3559 | 8.97e-09 | |
4 | 1l2z:A | 62 | 30 | 0.1176 | 0.1613 | 0.3333 | 0.35 | |
5 | 3kkj:A | 328 | 18 | 0.1059 | 0.0274 | 0.5000 | 0.50 | 3kkj:B, 5krq:A, 5krq:B, 4zcc:A, 4zcc:B, 4zcc:C, 4zcc:D, 4zcd:A, 4zcd:B |
6 | 1x87:A | 495 | 37 | 0.1412 | 0.0242 | 0.3243 | 0.93 | 1x87:B |
7 | 2fkn:B | 546 | 37 | 0.1412 | 0.0220 | 0.3243 | 2.1 | 2fkn:A, 2fkn:C, 2fkn:D |
8 | 5m1j:A6 | 539 | 32 | 0.1412 | 0.0223 | 0.3750 | 7.3 | |
9 | 8q9v:A | 543 | 38 | 0.1176 | 0.0184 | 0.2632 | 7.5 | 8q9u:A |
10 | 3ne8:A | 226 | 24 | 0.1059 | 0.0398 | 0.3750 | 8.4 | |
11 | 3p27:B | 444 | 32 | 0.1412 | 0.0270 | 0.3750 | 9.3 | 3p27:A |