BioLiP

>protein
VPVDYHLLMMFTKAEHNAPLQAKARVALSSLLRLAKFEAHEVLNLHFVSEEASREVAKALLRELLPPAAGFKCKVIFHDV
AVLTDKLFPVVEAMQKYFSAGSGTYYSDSIFFLSVAMHQIMPKEIPRIIQLDLDLKYKTNIRELFEEFDNFLPGAVIGIA
REMQPVYRHTFWQFRHENPKTRVGDPPPEGLPGFNSGVMLLNLEAMRQSPLYSHLLEPSWVQQLADKYHFRGHLGDQDFF
TMIGMEHPELFHVLDCTWNRQLCTWWRDHGYSDVFQAYFRCEGHVKIYHGNCNTPIPE

The query sequence (length=298) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4wm0:A	299	298	1.0000	0.9967	1.0000	0.0	4wlm:A, 4wlm:B, 4wlz:A, 4wlz:B, 4wma:A, 4wmb:A, 4wmi:A, 4wmk:A, 4wn2:A, 4wnh:A
2	7ui7:A	613	266	0.2181	0.1060	0.2444	8.28e-14	7ui6:A, 7ui6:B
3	7zvj:B	587	237	0.1879	0.0954	0.2363	1.21e-11	7zvj:A
4	1ss9:A	280	110	0.0973	0.1036	0.2636	0.019	1g9r:A, 1ga8:A
5	3rc8:A	610	68	0.0772	0.0377	0.3382	0.65	3rc3:A
6	7xxf:C	343	62	0.0671	0.0583	0.3226	2.4
7	5lfu:A	487	88	0.0839	0.0513	0.2841	2.6	5lf5:A, 5lfr:A, 5lfr:B, 5lfv:B, 5lfv:A
8	5dj4:A	366	97	0.0872	0.0710	0.2680	4.8	5dj4:B, 5dj4:C, 5dj4:D, 5dj4:E, 6n0m:A, 6n0m:B, 6n0m:C, 6n0m:D, 6n0m:E, 5t0n:A, 5t0n:B, 5t0n:C, 5t0n:D, 5t0n:E
9	5epe:A	248	45	0.0638	0.0766	0.4222	5.6
10	2b4f:A	404	41	0.0369	0.0272	0.2683	8.2	1h12:A, 1xwq:A
11	4cnz:A	100	45	0.0638	0.1900	0.4222	9.7	4cny:A, 4cnz:B, 4cnz:D, 4co4:A, 4co4:C, 4co4:B, 3o5t:B, 5ovo:B

[Back]