VPSPYLLSDKEVREIVQQSLSVGNFAARLLVRLFPELFTTENLRLQYNHSGACNKKQLDPTRLRLIRHYVEAVYPVEKME
EVWHYECIPSIDERCRRPN
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7v9g:D | 112 | 97 | 0.9798 | 0.8661 | 1.0000 | 1.20e-69 | 7v9f:A, 7v9g:A, 7v9g:G, 7v9g:J, 7v9i:A, 7w27:C |
2 | 4v6i:Bs | 257 | 79 | 0.2222 | 0.0856 | 0.2785 | 1.3 | 8ccs:DD, 8cdl:DD, 8cdr:DD, 8ceh:DD, 8cf5:DD, 8cg8:DD, 8cgn:DD, 8civ:DD, 8cku:DD, 8cmj:DD, 8eub:VA, 8evq:V, 8evr:V, 8evs:V, 8ewb:V, 6gq1:P0, 6gqb:P0, 6gqv:P0, 3j16:G, 5juo:VA, 5jup:VA, 5jus:VA, 5jut:VA, 5juu:VA, 8k2d:P0, 8k82:P0, 7osa:uL10, 7osm:uL10, 7rr5:P0, 4v7h:B8, 6woo:r, 6xiq:P0, 8y0u:P0 |
3 | 6m0w:A | 1032 | 81 | 0.2222 | 0.0213 | 0.2716 | 3.8 | 6m0v:A, 6m0x:A |
4 | 6sjv:A | 529 | 66 | 0.2020 | 0.0378 | 0.3030 | 3.9 | 6sqc:A |
5 | 8v45:B | 383 | 42 | 0.1212 | 0.0313 | 0.2857 | 4.7 | 8v45:A, 8v45:F, 8v45:C |
6 | 6rja:C | 815 | 42 | 0.1616 | 0.0196 | 0.3810 | 6.8 | 6rja:F, 6rjg:C |
7 | 8s9u:D | 518 | 41 | 0.1313 | 0.0251 | 0.3171 | 7.0 | 8s9t:D, 8s9v:D, 8s9x:D |
8 | 6rj9:C | 836 | 42 | 0.1616 | 0.0191 | 0.3810 | 7.2 | 6rjd:C |
9 | 4pi0:E | 390 | 41 | 0.1414 | 0.0359 | 0.3415 | 7.7 | 4phz:A, 4phz:E, 4phz:I, 4pi0:A, 4pi0:I, 4pi2:E, 4pi2:A, 4pi2:I, 3rfr:A, 3rfr:E, 3rfr:I, 7s4m:A, 7s4m:E, 7s4m:I |