VPMGKFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQIGRA
The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4ou6:A | 76 | 70 | 1.0000 | 0.9211 | 1.0000 | 6.73e-48 | 4ou6:B, 4ou6:C, 4ou6:D, 4ou6:E, 4ou7:A, 4ou7:B, 4ou7:C, 4ou7:D, 4ou7:E |
2 | 3s5w:B | 414 | 36 | 0.1429 | 0.0242 | 0.2778 | 0.79 | 3s5w:A, 3s61:A, 3s61:B |
3 | 6xrx:A | 551 | 38 | 0.1857 | 0.0236 | 0.3421 | 2.3 | |
4 | 8b3f:b | 534 | 52 | 0.2000 | 0.0262 | 0.2692 | 6.4 | 8b3d:b, 7oo3:b, 7oob:b, 7oop:b, 7opc:b, 7opd:b |
5 | 7evo:D | 200 | 27 | 0.1571 | 0.0550 | 0.4074 | 7.5 | 8hk1:D, 6n3e:A, 6n3f:C, 6nsx:A |
6 | 6hqv:A | 1555 | 31 | 0.1857 | 0.0084 | 0.4194 | 7.6 | 6hqv:B |
7 | 7k5n:A | 237 | 14 | 0.1143 | 0.0338 | 0.5714 | 8.0 | |
8 | 3j5s:D | 554 | 21 | 0.1714 | 0.0217 | 0.5714 | 8.3 | |
9 | 1wil:A | 89 | 32 | 0.1571 | 0.1236 | 0.3438 | 8.6 | 5xht:A |
10 | 3mru:A | 490 | 9 | 0.1000 | 0.0143 | 0.7778 | 9.8 | 3mru:B |
11 | 4pbp:B | 210 | 61 | 0.2286 | 0.0762 | 0.2623 | 9.9 | 4pbp:A, 4pbp:C |
12 | 5h59:A | 311 | 27 | 0.1571 | 0.0354 | 0.4074 | 10.0 | 5h5j:A, 5h5j:C, 1jb9:A, 3lo8:A, 3lvb:A, 5vw2:A, 5vw3:A, 5vw4:A, 5vw5:A, 5vw6:A, 5vw7:A, 5vw8:A, 5vw9:A, 5vwa:A, 5vwb:A |