VPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVERDDTEFQHPCF
LRGQEQLLENIKRK
The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7dcj:B | 110 | 101 | 0.9681 | 0.8273 | 0.9010 | 1.03e-63 | 5d5u:B, 5d5v:B, 5d5v:D, 7dcj:A, 7dcs:A, 7dcs:B, 7dcs:C, 7dcs:D, 7dcs:E, 7dcs:F, 7dct:A, 7dct:B, 7dct:C, 7dct:D, 7dct:E, 7dct:F, 5hdn:A, 5hdn:C |
2 | 7dcu:A | 101 | 94 | 0.7021 | 0.6535 | 0.7021 | 2.71e-43 | 7dci:A, 7dcu:C |
3 | 5d8k:B | 106 | 104 | 0.7234 | 0.6415 | 0.6538 | 2.22e-42 | 5d8l:B, 5d8l:D, 5d8l:F, 5d8l:H, 7dcu:B |
4 | 5d5x:B | 99 | 97 | 0.4681 | 0.4444 | 0.4536 | 3.65e-24 | 5d5w:B, 5d5x:E |
5 | 1fyk:A | 88 | 66 | 0.4149 | 0.4432 | 0.5909 | 1.21e-23 | 3hts:B |
6 | 1u17:A | 185 | 78 | 0.2128 | 0.1081 | 0.2564 | 1.2 | 1np1:A, 1np1:B, 2np1:A, 2np1:B, 3np1:A, 3np1:B, 4np1:A, 4np1:B, 1u17:B, 1u18:A, 1u18:B |
7 | 7yni:A | 566 | 31 | 0.1170 | 0.0194 | 0.3548 | 2.6 | |
8 | 7sla:A | 585 | 31 | 0.1170 | 0.0188 | 0.3548 | 2.6 | 7sl8:A |
9 | 7wmv:A | 602 | 31 | 0.1170 | 0.0183 | 0.3548 | 2.6 | |
10 | 2at0:X | 184 | 62 | 0.1702 | 0.0870 | 0.2581 | 4.3 | 2at3:X, 2at5:X, 2at6:X, 2at8:X, 3c76:X, 3c77:X, 3c78:X, 1d2u:A, 1d3s:A, 1eqd:A, 1erx:A, 3fll:A, 4gnw:A, 4gnw:B, 4grj:A, 4grj:B, 4hpa:A, 4hpb:A, 4hpc:A, 4hpd:A, 5hwz:A, 1ike:A, 1ikj:A, 1koi:A, 1ml7:A, 3mvf:A, 1np4:A, 2ofr:X, 1sxu:A, 1sxw:A, 1sxx:A, 1sxy:A, 1sy0:A, 1sy1:A, 1sy2:A, 1sy3:A, 3tga:A, 3tgb:A, 3tgc:A, 1u0x:A, 1x8n:A, 1x8o:A, 1x8p:A, 1x8q:A, 1ywa:A, 1ywb:A, 1ywc:A, 1ywd:A |
11 | 3o8o:E | 752 | 35 | 0.1170 | 0.0146 | 0.3143 | 4.6 | 3o8o:A, 3o8o:C, 3o8o:G |
12 | 7oya:a1 | 147 | 46 | 0.1702 | 0.1088 | 0.3478 | 6.9 | 7oyb:a1 |
13 | 1u2g:B | 359 | 32 | 0.0957 | 0.0251 | 0.2812 | 7.4 | 2fr8:A |
14 | 1f8g:A | 382 | 32 | 0.0957 | 0.0236 | 0.2812 | 7.4 | 1f8g:B, 1f8g:C, 1f8g:D, 2frd:A, 2frd:B, 2fsv:A, 1hzz:A, 1l7e:A, 1l7e:D, 1nm5:A, 1nm5:B, 2oo5:A, 2oo5:B, 2oor:A, 2oor:B, 1ptj:A, 1u28:A, 1u28:B, 1u2d:A, 1u2d:B, 1u2g:A, 1xlt:A, 1xlt:B, 1xlt:D, 1xlt:E, 1xlt:H, 1xlt:G |
15 | 7eld:A | 1137 | 45 | 0.1596 | 0.0132 | 0.3333 | 9.4 | 7ele:A |