VNFNLKANTTYLRLVEENDAEFICTLRNNDKLNTYISKSTGDIKSQAEWIRNYKNRENNGEEYYFIIFRSDDQSPIGTVR
LYDFHENPKSFCWGSWILNEHKTKYAAVESALLVYEAGFSTLGFEQSHFEVMKGNDKVHSFHLKMGAQKISEDDENIYYI
FPKSKYKENKIQYARFLGKLEHHHHHH
The query sequence (length=187) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ktc:A | 187 | 187 | 1.0000 | 1.0000 | 1.0000 | 3.61e-141 | 5ktd:A |
2 | 6d72:B | 176 | 140 | 0.1925 | 0.2045 | 0.2571 | 0.19 | 6d72:A |
3 | 8q3b:B | 1104 | 65 | 0.1016 | 0.0172 | 0.2923 | 0.25 | |
4 | 8q3k:B | 1020 | 61 | 0.0909 | 0.0167 | 0.2787 | 2.0 | |
5 | 3wr7:A | 170 | 169 | 0.2032 | 0.2235 | 0.2249 | 2.6 | 4r9m:A, 3wr7:C, 3wr7:B, 3wr7:D |
6 | 7wge:A | 698 | 55 | 0.0802 | 0.0215 | 0.2727 | 3.9 | |
7 | 7mwm:A | 74 | 29 | 0.0588 | 0.1486 | 0.3793 | 4.5 | 6c1a:A, 6c1a:B, 6c1a:E, 6c1a:F, 6c1t:A, 6c1t:D, 6c1u:A, 6c1u:B, 6c1u:E, 6c1u:F, 6c1v:A, 6c1v:B, 6c1v:E, 6c1v:F, 6c2f:A, 6c2f:D, 6c2f:G, 6c2f:J, 6c2f:M, 6c2f:P, 6cnp:A, 6cnp:B, 6cnq:A, 6cnq:B, 7mwk:A, 7mwk:B, 7mwm:B, 7ray:A |
8 | 2ky8:A | 70 | 29 | 0.0588 | 0.1571 | 0.3793 | 4.9 | |
9 | 8sr6:A | 451 | 64 | 0.1016 | 0.0421 | 0.2969 | 6.4 | 5czy:A, 8swi:A |